(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE360

ASFUM1_4.PE360       Location/Qualifiers
FT   CDS             join(1338940..1339534,1339588..1340246,1340305..1340558,
FT                   1340615..1341013,1341126..1341278,1341335..1341431,
FT                   1341543..1341944,1341988..1342026,1342080..1342322,
FT                   1342381..1343605,1343672..1344217,1344273..1344744,
FT                   1344800..1345085,1345142..1345239,1345290..1345382,
FT                   1345434..1345595,1345661..1345761,1345834..1346006,
FT                   1346057..1346342,1346396..1346593,1346641..1346765,
FT                   1346826..1346908,1346961..1347083,1347147..1347234,
FT                   1347284..1347541,1347589..1347780)
FT                   /codon_start=1
FT                   /gene_family="HOG000170185" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260049"
FT                   /orf_name="AFUA_4G04760"
FT                   /product="Inositol kinase kinase (UvsB), putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /protein_id="EAL84624.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG054471"
FT                   /db_xref="HOGENOM:HBG324449"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012993"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI0000F51AC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9I9"
FT                   /transl_table=1
FT                   /translation="MATNESWVPYQFTTTNSVSRSAEPASSILAAQLAPHLVSQGNSAH
FT                   GYLTRETFSQLRQELVDGKCSQLGLDDSIADASKLICIVLQAGIEPCVKGDRSRQGDFE
FT                   GQILDCLDIIQTILEKSPQVLGEICDPTILGENTSISLYAWLTLRLLNLLSWEANNIGK
FT                   RITSIFSSIIRPHYKHTTLLPFCYSALALLRACTNEIFLSLESHHNLLRQHMSEVRLSI
FT                   PAVKSAIFLTLDNLNLPRALLSKKITLGTFPQTITLALRLLDSFVPKRAFHSHTSIKDP
FT                   TLHQDLAWILNGIERLWRITHRWARTSMDDIEIKSRICMQFTSSLHIYRSLEPDISGLL
FT                   SPQSGLARPWVQICNDLVTLSLIQMPHLQAELGRLLDELIDASQPRLEVVTQFRAALLP
FT                   TMIDFKSKGTIQSFEPGFQAVLQILMGPMSGAESRSLVNLQEPNTAGQTGQQDEMLQHG
FT                   TTHDIPRPQEGSARLDTAHKLISKIFELLGCGEPVNVECLSHAISESFVDLPDQKKSDL
FT                   LYMLGRVACAMAGSLSSPSKAAPEISLSCSVCETEKRALGPEPASKPRDVHELCEIFTF
FT                   ILPRLTRASSLRVTAMDALRRLLVHAPPESCYLQLKSSVFGDFCLHSLRSSIRELRIVT
FT                   GRLVISFVRKDINADTRRSNFVVILEWLRSLSEKQELPLHETCILTLCHIAEVSDDEEM
FT                   NIILLRLLEYLGHPNPFICAVAYAELSKLAQRLSVTPAGLFRPFWRTLSITVVKNFQSR
FT                   PHMAEQLCDLLGMNVDDFLRLTEVHILPYLVLTRKRDVITRVGAAYKHIKTPFDICSEK
FT                   NNLAAILAFLMSQPWSDPEGMIMSVLSDIDSAFGGRTLAELALVIREVRKAHGHFHRAL
FT                   HLLAALVPRKSTATSKKANLLCHFIEEHVLGIITQFAHAINDFQIRQPLIEKRRNILAI
FT                   GEMIKVARGHISSALPQICACLRSALSIEELSDHAFSAWSVLVSSLHEEELEPLIDQTF
FT                   SIVIRYWDAFNYQSKKTAEELIGYILRSHSGLVHTNFSTIPSLASIPALSALESEISKM
FT                   KEKMDVRSQLSAFGRRCQSENAAVVEQALRELLPCLSRHEEFLHESVLSEQPDPVVAQL
FT                   TRSLLDCCVKFNAGSDSITLLSAQCLGLVGCLDPNRVDPVKDKKDILVLSNFDRMEETF
FT                   DFVLFFLQHVLVQAFLSASNTRAQGFLAYAMQNLLRLCNLDSAVTQRSRDVQADEKYRR
FT                   WSELPETVRNTLTPFLTSKYTVTVGAIRSRCKFPIFSTELTHGDWLRSFVQDLLQRGSG
FT                   DNAQLIFSVCSRIVKGQDISIASFLLPFAVLNRIVGGTQEERLDLQSELTTILSHPLPE
FT                   ASNRVHEAIILCRQSVFEILDYLSRWLQGKKKLLHGLKNHASHTGRSHKDSHQDSLSET
FT                   YSSQVKAVETFLGSIPPEVISKRAVECKSFSRALFHWEQYIRRFKSQSDKNDHTSTELL
FT                   YQHLQVIYSQIDEPDGIEGISSHLHVLNIDQQVLQHRKAGRWVTAQSWYELQVEKEPDN
FT                   IDAQWNLLTCLRESGQQDAIIARVDTLNSAGSTSRFLPFAVEASWITGNWDKLRSYLQM
FT                   RSPENTGDFNIGVGSALCALRLGNKTEFRNIIHDLQLSVAKSLTVNSVTSLQSCHDSIL
FT                   KLHALTEMELISDCEGTENSSLTSIHDVLNRRLDVLGGYIADKQYLLGLRRATMELTHG
FT                   FMESDIAGSWLTSARLSRKGNYTNQAYHSMLRAARLKDRSATIEHARLLWKDGHHRKAI
FT                   QTLEGAIAANEFASDTSSSGGLKNEKQQNLIAARAHLLLAKWTDRAGQTQSDVIVQRYR
FT                   EAIKLHSRWEKAHYYLGKHYDKILESEKAKPLGKEAQIYLSGEASKLVIDNYLRSLAHG
FT                   NKYVFQSLPRILTLWLEHAATVDKPFDPKRGDNEEFQTHTLNQRKKTLDDMHSQLKKYL
FT                   NRMPAALVMVARICHPHATVYELLTRIVAKVANAFPQQGLWTVLAVVKSSSKDRASRGI
FT                   NCLHKITEANKKSRTEFPLDMRGMINQGQKFTEEMLKLCTARVEEKASRIHLARHLGFS
FT                   HKVAPCRLVVPFQAMLTPSLPASHETEYLKGFRAFPRDPTTIDAVLDDAQVLSSLQKPR
FT                   KISIRGSDGKIYNVLCKPKDDLRKDQRLMEFNNTINRFLKKDVESSKRRMYIKTYAVTP
FT                   LNEECGLIEWVDNLRTLREIIIKLLKERGIMPNYNEIRHYLNEACSEASKLHLFTTKVL
FT                   MKFPPVLHEWFVEMFPETGAWFAARLRYTRSCAVMSMVGYVLGLGDRHGENILFEEGTG
FT                   GVIHVDFNCLFDKGLTFEKPELVPFRLTQNMIDAFGAYGYNGLFPKSLKDEAFAQLLFT
FT                   GPFRRTCEISLRLLRQNEDALMTVLETFLHDPTTDFIGKKRRTHANVPETPAGVLENVR
FT                   NKLRGLLPGESVPLSVDGHVDELITQATDKRNLAAMYIGWCAFF"
     MATNESWVPY QFTTTNSVSR SAEPASSILA AQLAPHLVSQ GNSAHGYLTR ETFSQLRQEL        60
     VDGKCSQLGL DDSIADASKL ICIVLQAGIE PCVKGDRSRQ GDFEGQILDC LDIIQTILEK       120
     SPQVLGEICD PTILGENTSI SLYAWLTLRL LNLLSWEANN IGKRITSIFS SIIRPHYKHT       180
     TLLPFCYSAL ALLRACTNEI FLSLESHHNL LRQHMSEVRL SIPAVKSAIF LTLDNLNLPR       240
     ALLSKKITLG TFPQTITLAL RLLDSFVPKR AFHSHTSIKD PTLHQDLAWI LNGIERLWRI       300
     THRWARTSMD DIEIKSRICM QFTSSLHIYR SLEPDISGLL SPQSGLARPW VQICNDLVTL       360
     SLIQMPHLQA ELGRLLDELI DASQPRLEVV TQFRAALLPT MIDFKSKGTI QSFEPGFQAV       420
     LQILMGPMSG AESRSLVNLQ EPNTAGQTGQ QDEMLQHGTT HDIPRPQEGS ARLDTAHKLI       480
     SKIFELLGCG EPVNVECLSH AISESFVDLP DQKKSDLLYM LGRVACAMAG SLSSPSKAAP       540
     EISLSCSVCE TEKRALGPEP ASKPRDVHEL CEIFTFILPR LTRASSLRVT AMDALRRLLV       600
     HAPPESCYLQ LKSSVFGDFC LHSLRSSIRE LRIVTGRLVI SFVRKDINAD TRRSNFVVIL       660
     EWLRSLSEKQ ELPLHETCIL TLCHIAEVSD DEEMNIILLR LLEYLGHPNP FICAVAYAEL       720
     SKLAQRLSVT PAGLFRPFWR TLSITVVKNF QSRPHMAEQL CDLLGMNVDD FLRLTEVHIL       780
     PYLVLTRKRD VITRVGAAYK HIKTPFDICS EKNNLAAILA FLMSQPWSDP EGMIMSVLSD       840
     IDSAFGGRTL AELALVIREV RKAHGHFHRA LHLLAALVPR KSTATSKKAN LLCHFIEEHV       900
     LGIITQFAHA INDFQIRQPL IEKRRNILAI GEMIKVARGH ISSALPQICA CLRSALSIEE       960
     LSDHAFSAWS VLVSSLHEEE LEPLIDQTFS IVIRYWDAFN YQSKKTAEEL IGYILRSHSG      1020
     LVHTNFSTIP SLASIPALSA LESEISKMKE KMDVRSQLSA FGRRCQSENA AVVEQALREL      1080
     LPCLSRHEEF LHESVLSEQP DPVVAQLTRS LLDCCVKFNA GSDSITLLSA QCLGLVGCLD      1140
     PNRVDPVKDK KDILVLSNFD RMEETFDFVL FFLQHVLVQA FLSASNTRAQ GFLAYAMQNL      1200
     LRLCNLDSAV TQRSRDVQAD EKYRRWSELP ETVRNTLTPF LTSKYTVTVG AIRSRCKFPI      1260
     FSTELTHGDW LRSFVQDLLQ RGSGDNAQLI FSVCSRIVKG QDISIASFLL PFAVLNRIVG      1320
     GTQEERLDLQ SELTTILSHP LPEASNRVHE AIILCRQSVF EILDYLSRWL QGKKKLLHGL      1380
     KNHASHTGRS HKDSHQDSLS ETYSSQVKAV ETFLGSIPPE VISKRAVECK SFSRALFHWE      1440
     QYIRRFKSQS DKNDHTSTEL LYQHLQVIYS QIDEPDGIEG ISSHLHVLNI DQQVLQHRKA      1500
     GRWVTAQSWY ELQVEKEPDN IDAQWNLLTC LRESGQQDAI IARVDTLNSA GSTSRFLPFA      1560
     VEASWITGNW DKLRSYLQMR SPENTGDFNI GVGSALCALR LGNKTEFRNI IHDLQLSVAK      1620
     SLTVNSVTSL QSCHDSILKL HALTEMELIS DCEGTENSSL TSIHDVLNRR LDVLGGYIAD      1680
     KQYLLGLRRA TMELTHGFME SDIAGSWLTS ARLSRKGNYT NQAYHSMLRA ARLKDRSATI      1740
     EHARLLWKDG HHRKAIQTLE GAIAANEFAS DTSSSGGLKN EKQQNLIAAR AHLLLAKWTD      1800
     RAGQTQSDVI VQRYREAIKL HSRWEKAHYY LGKHYDKILE SEKAKPLGKE AQIYLSGEAS      1860
     KLVIDNYLRS LAHGNKYVFQ SLPRILTLWL EHAATVDKPF DPKRGDNEEF QTHTLNQRKK      1920
     TLDDMHSQLK KYLNRMPAAL VMVARICHPH ATVYELLTRI VAKVANAFPQ QGLWTVLAVV      1980
     KSSSKDRASR GINCLHKITE ANKKSRTEFP LDMRGMINQG QKFTEEMLKL CTARVEEKAS      2040
     RIHLARHLGF SHKVAPCRLV VPFQAMLTPS LPASHETEYL KGFRAFPRDP TTIDAVLDDA      2100
     QVLSSLQKPR KISIRGSDGK IYNVLCKPKD DLRKDQRLME FNNTINRFLK KDVESSKRRM      2160
     YIKTYAVTPL NEECGLIEWV DNLRTLREII IKLLKERGIM PNYNEIRHYL NEACSEASKL      2220
     HLFTTKVLMK FPPVLHEWFV EMFPETGAWF AARLRYTRSC AVMSMVGYVL GLGDRHGENI      2280
     LFEEGTGGVI HVDFNCLFDK GLTFEKPELV PFRLTQNMID AFGAYGYNGL FPKSLKDEAF      2340
     AQLLFTGPFR RTCEISLRLL RQNEDALMTV LETFLHDPTT DFIGKKRRTH ANVPETPAGV      2400
     LENVRNKLRG LLPGESVPLS VDGHVDELIT QATDKRNLAA MYIGWCAFF                  2449
//

If you have problems or comments...

PBIL Back to PBIL home page