(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE362

ASFUM1_4.PE362       Location/Qualifiers
FT   CDS             join(complement(1353437..1353466),
FT                   complement(1353105..1353372),complement(1352722..1353044))
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206595"
FT                   /orf_name="AFUA_4G04810"
FT                   /product="Rab GTPase SrgA, putative "
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="EAL84629.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI000051E81B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W9I4"
FT                   /transl_table=1
FT                   /translation="MAGTRNYDFLIKLLLIGDSGVGKSCCLLRFSEDSFTPSFITTIGI
FT                   DFKIRTIELDGKRVKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDERSFQNIRTW
FT                   FSNVEQHASEGVHKILIGNKCDWEEKRAVSTEQGQQLADELGIPFLEVSAKNNINIEKA
FT                   FYSLASAIKKGMDTSKSEQVGSQGVNIDHHGSGTSGSTGGKCC"
     MAGTRNYDFL IKLLLIGDSG VGKSCCLLRF SEDSFTPSFI TTIGIDFKIR TIELDGKRVK        60
     LQIWDTAGQE RFRTITTAYY RGAMGILLVY DVTDERSFQN IRTWFSNVEQ HASEGVHKIL       120
     IGNKCDWEEK RAVSTEQGQQ LADELGIPFL EVSAKNNINI EKAFYSLASA IKKGMDTSKS       180
     EQVGSQGVNI DHHGSGTSGS TGGKCC                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page