(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE366

ASFUM1_4.PE366       Location/Qualifiers
FT   CDS             join(1491975..1492365,1492477..1493000)
FT                   /codon_start=1
FT                   /gene_family="HOG000036504" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260051"
FT                   /orf_name="AFUA_4G05850"
FT                   /product="Malonyl CoA-acyl carrier protein transacylase,
FT                   putative"
FT                   /EC_number="2.3.1.39"
FT                   /function="[acyl-carrier-protein] S-malonyltransferase
FT                   activity"
FT                   /protein_id="EAL90201.1"
FT                   /db_xref="GO:0004314"
FT                   /db_xref="HOGENOM:HBG054290"
FT                   /db_xref="HOGENOM:HBG687898"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI000051F2A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNI3"
FT                   /transl_table=1
FT                   /translation="MANSWVDNFPGTARPFLDEMDDTLGFNLSRTIANGPNCELNKTEN
FT                   SQPAIMATSILILRILEKEFGFDTKSRVNVTLGHSLGEFSALVAGGYLKFRDALRLVRR
FT                   RAEIMAECTRQASKQSGEDYGMVALIFMIANINSKNQIVLSGSIHRITTLLIQLRQFGG
FT                   HDPRAVRLKSESPFHNPIMAPAAGYMRHELEHIDIEFPSQLPCISNVSGLPFESRDDLK
FT                   NLLSRQCVETVKWWDSIRYLDQDRGVKRWIGIGPGKVGRNLVGKEVGKINTKGGGVWAL
FT                   SDPRELENVLMALQNTEIDVLTQ"
     MANSWVDNFP GTARPFLDEM DDTLGFNLSR TIANGPNCEL NKTENSQPAI MATSILILRI        60
     LEKEFGFDTK SRVNVTLGHS LGEFSALVAG GYLKFRDALR LVRRRAEIMA ECTRQASKQS       120
     GEDYGMVALI FMIANINSKN QIVLSGSIHR ITTLLIQLRQ FGGHDPRAVR LKSESPFHNP       180
     IMAPAAGYMR HELEHIDIEF PSQLPCISNV SGLPFESRDD LKNLLSRQCV ETVKWWDSIR       240
     YLDQDRGVKR WIGIGPGKVG RNLVGKEVGK INTKGGGVWA LSDPRELENV LMALQNTEID       300
     VLTQ                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page