(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE371

ASFUM1_4.PE371       Location/Qualifiers
FT   CDS             join(complement(1501614..1501891),
FT                   complement(1501042..1501534))
FT                   /codon_start=1
FT                   /gene_family="HOG000187553" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206597"
FT                   /orf_name="AFUA_4G05890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90197.1"
FT                   /db_xref="HOGENOM:HBG054286"
FT                   /db_xref="HOGENOM:HBG324388"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000052056D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNI7"
FT                   /transl_table=1
FT                   /translation="MGAKILPMEATIPDKPSSPNLVAAFDVSEHLVPVRELKPAGNTLV
FT                   SFDGLLEEPLILKEDLKEGCGGQLWPAGIVLAKYLLRQHRNNLSNKTIVELGAGGGLVG
FT                   LAVARGCDVGPCPIYITDQEPMLHLMKTNIELNNLSTAVAATVLNWGERLPDCIPTHPE
FT                   IVLAADCVYFEPAFPLLISTLQDLLGPESVCYFCFKRRRRADLRFMKAAKRVFDIKEVR
FT                   DDPEADTYRRENIFLYSLRLRFRPENGSLRAIKE"
     MGAKILPMEA TIPDKPSSPN LVAAFDVSEH LVPVRELKPA GNTLVSFDGL LEEPLILKED        60
     LKEGCGGQLW PAGIVLAKYL LRQHRNNLSN KTIVELGAGG GLVGLAVARG CDVGPCPIYI       120
     TDQEPMLHLM KTNIELNNLS TAVAATVLNW GERLPDCIPT HPEIVLAADC VYFEPAFPLL       180
     ISTLQDLLGP ESVCYFCFKR RRRADLRFMK AAKRVFDIKE VRDDPEADTY RRENIFLYSL       240
     RLRFRPENGS LRAIKE                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page