(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE372

ASFUM1_4.PE372       Location/Qualifiers
FT   CDS             join(1503158..1503173,1503241..1503545,1503611..1503745)
FT                   /codon_start=1
FT                   /gene_family="HOG000187564" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260054"
FT                   /orf_name="AFUA_4G05900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90196.2"
FT                   /db_xref="HOGENOM:HBG054285"
FT                   /db_xref="HOGENOM:HBG324387"
FT                   /db_xref="InterPro:IPR013879"
FT                   /db_xref="UniParc:UPI0000F51BFB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNI8"
FT                   /transl_table=1
FT                   /translation="MTTLHYLPPVKPSAIAMGTIFTHTASLGILAPVFGDTYHRAQAAN
FT                   SKEEFIKSKEAAGAAAAWGSSLVGSAVQTYGVAALINATGTLSYKGAAYLGSLIFMASS
FT                   APSFISQIFTEKRPLDTVAVGAVSRVFETVGLSLFLTWWGTRTNPFD"
     MTTLHYLPPV KPSAIAMGTI FTHTASLGIL APVFGDTYHR AQAANSKEEF IKSKEAAGAA        60
     AAWGSSLVGS AVQTYGVAAL INATGTLSYK GAAYLGSLIF MASSAPSFIS QIFTEKRPLD       120
     TVAVGAVSRV FETVGLSLFL TWWGTRTNPF D                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page