(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE373

ASFUM1_4.PE373       Location/Qualifiers
FT   CDS             join(complement(1505044..1505103),
FT                   complement(1504489..1504970),complement(1504414..1504438))
FT                   /codon_start=1
FT                   /gene_family="HOG000187575" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260055"
FT                   /orf_name="AFUA_4G05910"
FT                   /product="NADH-ubiquinone oxidoreductase 21 kDa subunit,
FT                   putative"
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EBA27398.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324386"
FT                   /db_xref="InterPro:IPR016813"
FT                   /db_xref="UniParc:UPI0000F51C1B"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9N7"
FT                   /transl_table=1
FT                   /translation="MTRDVLKAAKSASNAIAVHKSTGIWERLRRLLAIDPNRSTGVPLN
FT                   SQYRLPTPGALPPQSYDDPVTVPAADIADNPYWKRDVRRNYPRLSIVNQADAVGLLTVG
FT                   SRAAPKDDVLQTGQAGEQQLVEVKQQGEERGLAAIFEKDKRGIQGVLGADGLPPTPCNL
FT                   NASAAKYQLGQGQGYPAVYPCRTFV"
     MTRDVLKAAK SASNAIAVHK STGIWERLRR LLAIDPNRST GVPLNSQYRL PTPGALPPQS        60
     YDDPVTVPAA DIADNPYWKR DVRRNYPRLS IVNQADAVGL LTVGSRAAPK DDVLQTGQAG       120
     EQQLVEVKQQ GEERGLAAIF EKDKRGIQGV LGADGLPPTP CNLNASAAKY QLGQGQGYPA       180
     VYPCRTFV                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page