(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE376

ASFUM1_4.PE376       Location/Qualifiers
FT   CDS             join(complement(1509472..1509515),
FT                   complement(1508653..1509412))
FT                   /codon_start=1
FT                   /gene_family="HOG000187597" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260057"
FT                   /orf_name="AFUA_4G05930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90193.2"
FT                   /db_xref="HOGENOM:HBG054282"
FT                   /db_xref="HOGENOM:HBG324385"
FT                   /db_xref="UniParc:UPI0000F51BCB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ1"
FT                   /transl_table=1
FT                   /translation="MATKRISTLDYLRKAHEGRIYWFNTVHFSRADISRIPYFDPRKLS
FT                   RRAINYLLLGISLPPILDVNSSPSEYLRALNALLIEFEAFQQVHPPDGSSSSTLARARI
FT                   PQMFKRAAHAGTKGRRASSATEIGLPMQSSDPSDLKSMTGNITSSTTAAAAVVSFPTSE
FT                   ASELLPGEEYSYLLTPSLPFEPDYFETFATLCDVLIDCYTRLTALVSTPSVCTVALGEM
FT                   FSKADAKLRKIMVTGVVREFEDASRTSAKNEIAGVSRVVLGGLLG"
     MATKRISTLD YLRKAHEGRI YWFNTVHFSR ADISRIPYFD PRKLSRRAIN YLLLGISLPP        60
     ILDVNSSPSE YLRALNALLI EFEAFQQVHP PDGSSSSTLA RARIPQMFKR AAHAGTKGRR       120
     ASSATEIGLP MQSSDPSDLK SMTGNITSST TAAAAVVSFP TSEASELLPG EEYSYLLTPS       180
     LPFEPDYFET FATLCDVLID CYTRLTALVS TPSVCTVALG EMFSKADAKL RKIMVTGVVR       240
     EFEDASRTSA KNEIAGVSRV VLGGLLG                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page