(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE378

ASFUM1_4.PE378       Location/Qualifiers
FT   CDS             join(complement(1513062..1513091),
FT                   complement(1512708..1512987),complement(1512460..1512611))
FT                   /codon_start=1
FT                   /gene_family="HOG000095211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260059"
FT                   /orf_name="AFUA_4G05950"
FT                   /product="Glutaredoxin Grx5, putative "
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="EAL90191.2"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG054279"
FT                   /db_xref="HOGENOM:HBG728471"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000F51BCE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ3"
FT                   /transl_table=1
FT                   /translation="MMFQRQAFAPAFRPFSRSPLVLTPRFTAFQLPHALHARFLSEQTR
FT                   SAIDKAIASAPVVLFMKGTPETPQCGFSRASIQILGLQGVDPKKFVAFNVLEDPELRQG
FT                   IKEYSDWPTIPQLYLDKEFIGGCDILMSMHQNGELAKLLEEKGVLVAAD"
     MMFQRQAFAP AFRPFSRSPL VLTPRFTAFQ LPHALHARFL SEQTRSAIDK AIASAPVVLF        60
     MKGTPETPQC GFSRASIQIL GLQGVDPKKF VAFNVLEDPE LRQGIKEYSD WPTIPQLYLD       120
     KEFIGGCDIL MSMHQNGELA KLLEEKGVLV AAD                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page