(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE379

ASFUM1_4.PE379       Location/Qualifiers
FT   CDS             join(1513491..1513974,1514032..1514279)
FT                   /codon_start=1
FT                   /gene_family="HOG000187629" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260060"
FT                   /orf_name="AFUA_4G05960"
FT                   /product="Flavoprotein, putative"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL90190.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG054278"
FT                   /db_xref="HOGENOM:HBG523890"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="UniParc:UPI0000F51BD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ4"
FT                   /transl_table=1
FT                   /translation="MEGMGTLSAEEQFKDKKIHILLAASGSVAAIKLPNIAEALGRHKN
FT                   VCIRIIVTKSAEKFLSGQSSEQPLLNALEQLPGVDAIYRDEDEWKDPWTRGEPILHIEL
FT                   RKWAHVLLVAPLSANTLAKMTMGIADNLLLSVIRAWDTTGKVDSGLKDRKPVVFVAPAM
FT                   NTAMWNHPATKRQLKILTDEWGVSRTNEEGWVTVLHPIEKSLACGDTGNGAMMDWKDIV
FT                   NVVEHHLGISSVKIKDIRCGT"
     MEGMGTLSAE EQFKDKKIHI LLAASGSVAA IKLPNIAEAL GRHKNVCIRI IVTKSAEKFL        60
     SGQSSEQPLL NALEQLPGVD AIYRDEDEWK DPWTRGEPIL HIELRKWAHV LLVAPLSANT       120
     LAKMTMGIAD NLLLSVIRAW DTTGKVDSGL KDRKPVVFVA PAMNTAMWNH PATKRQLKIL       180
     TDEWGVSRTN EEGWVTVLHP IEKSLACGDT GNGAMMDWKD IVNVVEHHLG ISSVKIKDIR       240
     CGT                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page