(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE38

ASFUM1_4.PE38        Location/Qualifiers
FT   CDS             join(complement(127632..127848),complement(126741..127500),
FT                   complement(126278..126694),complement(125315..126230))
FT                   /codon_start=1
FT                   /gene_family="HOG000200311" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20753330"
FT                   /orf_name="AFUA_4G00490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84369.1"
FT                   /db_xref="HOGENOM:HBG054127"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000051FC28"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W972"
FT                   /transl_table=1
FT                   /translation="MRFSWQRSAGISALLVGCSLAQGWNVNVSMCNWDQVRGILRPSCP
FT                   SAAKAYMSQLVRFATLFTLTEGHCGGSGNSDGLLYYLNLNTSFDTAISNLTALFGNISK
FT                   AGGIANNIAPTYRDGAMFTNDNELYLYGYFDSLFTNSRLTICSGLLRLTDSQDPPAGNT
FT                   VLGYERYQYGPDRESWQPGFIIDNLDTGVTRYVTNGAGVSAPNENLGFYFSGMRGKDWG
FT                   PIYADDKSANVTSDRMIKVDMSSMRHNKWSNLSLPAHVPARANGELVWVPVAESGVLVA
FT                   IGGVINPATIFSSDGLTSAQQNASKRVSPGLMETVSVYDVSGDKWYLQNTTGDIPPQLT
FT                   QFCSIHASAQDGSSHNIYIYGGYDGLSMENTPSDDVYVLSLPSFSWIKLYSGNTTHGRS
FT                   GHRCVKPYPDQMLVLGGVHLDPTHCLDGGVIQVFNLNTGRFQNTYNPNVWNEYKVPDLI
FT                   TTVIGGDSEGGATKASPISWTNASLADVFKTKYTNTISTWYPYNSTSSISPTIAPAADK
FT                   GSSFPKWASAIIGVILGFLFISAAAIFWFLRRRHKLRESQSTGDRSTRSWILRWLHTSG
FT                   SATGVPKSGDTTAPTGYSVFTNESTITPATAVSPQSVEAGSDPVYEMLGQFFNLLFLYP
FT                   ANHCEGHATTLPVELPTPYNNNSLPSPVSPPGVSGTDYVSPITVSTPSTEDEASPVRPP
FT                   HYRHMSSLSSVPTIANVMRKESRHRQTYRSDTSEGSVELECPRGVELSGSTPQEGRLAT
FT                   TREVDELEGLGIKALP"
     MRFSWQRSAG ISALLVGCSL AQGWNVNVSM CNWDQVRGIL RPSCPSAAKA YMSQLVRFAT        60
     LFTLTEGHCG GSGNSDGLLY YLNLNTSFDT AISNLTALFG NISKAGGIAN NIAPTYRDGA       120
     MFTNDNELYL YGYFDSLFTN SRLTICSGLL RLTDSQDPPA GNTVLGYERY QYGPDRESWQ       180
     PGFIIDNLDT GVTRYVTNGA GVSAPNENLG FYFSGMRGKD WGPIYADDKS ANVTSDRMIK       240
     VDMSSMRHNK WSNLSLPAHV PARANGELVW VPVAESGVLV AIGGVINPAT IFSSDGLTSA       300
     QQNASKRVSP GLMETVSVYD VSGDKWYLQN TTGDIPPQLT QFCSIHASAQ DGSSHNIYIY       360
     GGYDGLSMEN TPSDDVYVLS LPSFSWIKLY SGNTTHGRSG HRCVKPYPDQ MLVLGGVHLD       420
     PTHCLDGGVI QVFNLNTGRF QNTYNPNVWN EYKVPDLITT VIGGDSEGGA TKASPISWTN       480
     ASLADVFKTK YTNTISTWYP YNSTSSISPT IAPAADKGSS FPKWASAIIG VILGFLFISA       540
     AAIFWFLRRR HKLRESQSTG DRSTRSWILR WLHTSGSATG VPKSGDTTAP TGYSVFTNES       600
     TITPATAVSP QSVEAGSDPV YEMLGQFFNL LFLYPANHCE GHATTLPVEL PTPYNNNSLP       660
     SPVSPPGVSG TDYVSPITVS TPSTEDEASP VRPPHYRHMS SLSSVPTIAN VMRKESRHRQ       720
     TYRSDTSEGS VELECPRGVE LSGSTPQEGR LATTREVDEL EGLGIKALP                   769
//

If you have problems or comments...

PBIL Back to PBIL home page