(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE381

ASFUM1_4.PE381       Location/Qualifiers
FT   CDS             join(1516535..1516802,1516876..1518875)
FT                   /codon_start=1
FT                   /gene_family="HOG000187630" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260061"
FT                   /orf_name="AFUA_4G05980"
FT                   /product="JmjC domain protein, putative "
FT                   /protein_id="EAL90188.2"
FT                   /db_xref="HOGENOM:HBG054276"
FT                   /db_xref="HOGENOM:HBG324382"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR018866"
FT                   /db_xref="UniParc:UPI0000F51BB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ6"
FT                   /transl_table=1
FT                   /translation="MPAQRPRAAFEPIPPDLDVAALVESTPNFEYVVRIHCNSIDEHGL
FT                   DNFDKLVRLHVILGGKPLVIEGFHERLDRSVFSERWLRSHHSSRKEIARNLTTKSNLPL
FT                   SIGHYLKNMPMLTNQWNSFNYKNSDKQRIYLKDIDCPQTWHDHLKNLIPPPLFYLNKHP
FT                   EAFQGPGGESVTATEKHQTHAEPRNKVGKPGDLMSCLPASMRAENLMCYIGHEGTYTPA
FT                   HYEMCASLGQNIMVEASDGSVEYGMKTIPGSSIWFMTESKDRRVVSEYWQSTLGHDINI
FT                   EDHFAQINAWKSAPFRTYIVEQRPGDFILIPPLAAHQVWNRGTRTMKVAWNRTTVETLS
FT                   LALSEALPQARTVCRDEQYKNKAIVFYSLEHYSKLLGDIDGKSMDSKQQLLLKDFEHLF
FT                   ALYTQILLSESFSQDEAEEKDIEYIPFDSNITCSYCRCNIFNRFLTCPWCAGGQTADGE
FT                   DPYDICMECYVMGRSCACLSRLKWAEQFPWSELTGNYENWRDQICRLNQGNPNGQIFRP
FT                   LAEERARYGKKTLAEMCQGELKRRPWVDITKPVTRKIEDNLSDPESPARKRRKTRLSHE
FT                   SEKGGRCHICKYIEPKWKLASCDYCNQNYCYGSLFRAFNIQPHETMEVYRWMCPKCQKV
FT                   CSCAACRRDPSMKPFEPTCTLLGHDTRKIADPRSVESLVDFRQSNLRWLKKAGDNEIER
FT                   LKKHQKEADEKRQQAMIEYSIQLEDSPRVSAHATKYGDIPVDPVLEELSGSILTPPDSF
FT                   TP"
     MPAQRPRAAF EPIPPDLDVA ALVESTPNFE YVVRIHCNSI DEHGLDNFDK LVRLHVILGG        60
     KPLVIEGFHE RLDRSVFSER WLRSHHSSRK EIARNLTTKS NLPLSIGHYL KNMPMLTNQW       120
     NSFNYKNSDK QRIYLKDIDC PQTWHDHLKN LIPPPLFYLN KHPEAFQGPG GESVTATEKH       180
     QTHAEPRNKV GKPGDLMSCL PASMRAENLM CYIGHEGTYT PAHYEMCASL GQNIMVEASD       240
     GSVEYGMKTI PGSSIWFMTE SKDRRVVSEY WQSTLGHDIN IEDHFAQINA WKSAPFRTYI       300
     VEQRPGDFIL IPPLAAHQVW NRGTRTMKVA WNRTTVETLS LALSEALPQA RTVCRDEQYK       360
     NKAIVFYSLE HYSKLLGDID GKSMDSKQQL LLKDFEHLFA LYTQILLSES FSQDEAEEKD       420
     IEYIPFDSNI TCSYCRCNIF NRFLTCPWCA GGQTADGEDP YDICMECYVM GRSCACLSRL       480
     KWAEQFPWSE LTGNYENWRD QICRLNQGNP NGQIFRPLAE ERARYGKKTL AEMCQGELKR       540
     RPWVDITKPV TRKIEDNLSD PESPARKRRK TRLSHESEKG GRCHICKYIE PKWKLASCDY       600
     CNQNYCYGSL FRAFNIQPHE TMEVYRWMCP KCQKVCSCAA CRRDPSMKPF EPTCTLLGHD       660
     TRKIADPRSV ESLVDFRQSN LRWLKKAGDN EIERLKKHQK EADEKRQQAM IEYSIQLEDS       720
     PRVSAHATKY GDIPVDPVLE ELSGSILTPP DSFTP                                  755
//

If you have problems or comments...

PBIL Back to PBIL home page