(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE384

ASFUM1_4.PE384       Location/Qualifiers
FT   CDS             join(complement(1521306..1522161),
FT                   complement(1521143..1521240))
FT                   /codon_start=1
FT                   /gene_family="HOG000100368" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18206599"
FT                   /orf_name="AFUA_4G06000"
FT                   /product="50S ribosomal protein L3 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL90186.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG054274"
FT                   /db_xref="HOGENOM:HBG734653"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniParc:UPI0000F51C2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ8"
FT                   /transl_table=1
FT                   /translation="MLQGRDCFEYHSIIGQTILTMSPRLSRKLTQLPTLFLGLPSLTIT
FT                   GNVSVRSFGIKSLNPPKPSRFNIGPELPVLKSTSTAALERKANTLPLRTGAIAIKKGMT
FT                   AVYDAETGKRIACTVLQLDRVQVVSHKTRQTHGYNAVQVGAGWKHPSNVTKSLLGHFST
FT                   NGVSPKRHVYEFRVKDESGLLPVGQTINADWFQEGQYVDARSYSKGKGFAGVMKRHGFH
FT                   GQDRSHGVSLTHRSLGSAGPSQGGGSRVYPGKKMAGNMGNEQNTVQNLKVLKVDADNGI
FT                   VVVNGSVSGPKGCVVRIQDAIKKPWPEIAHVSKTAA"
     MLQGRDCFEY HSIIGQTILT MSPRLSRKLT QLPTLFLGLP SLTITGNVSV RSFGIKSLNP        60
     PKPSRFNIGP ELPVLKSTST AALERKANTL PLRTGAIAIK KGMTAVYDAE TGKRIACTVL       120
     QLDRVQVVSH KTRQTHGYNA VQVGAGWKHP SNVTKSLLGH FSTNGVSPKR HVYEFRVKDE       180
     SGLLPVGQTI NADWFQEGQY VDARSYSKGK GFAGVMKRHG FHGQDRSHGV SLTHRSLGSA       240
     GPSQGGGSRV YPGKKMAGNM GNEQNTVQNL KVLKVDADNG IVVVNGSVSG PKGCVVRIQD       300
     AIKKPWPEIA HVSKTAA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page