(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE385

ASFUM1_4.PE385       Location/Qualifiers
FT   CDS             join(1522634..1523243,1523324..1523475)
FT                   /codon_start=1
FT                   /gene_family="HOG000187663" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260063"
FT                   /orf_name="AFUA_4G06010"
FT                   /product="Peptide alpha-N-acetyltransferase Nat2, putative "
FT                   /function="transferase activity"
FT                   /protein_id="EAL90185.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG054273"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniParc:UPI00005200C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNJ9"
FT                   /transl_table=1
FT                   /translation="MSLKFITTPRWFSHLIGQAGHAPSLSFVRKNVTSSQGLFTPNIVA
FT                   SFPSRRAFASSPAWKSNPQYRFFPRQSGSTTTFTYNPPSTLQRSIFRRFNSSRANQSAR
FT                   PAESGSLSQRLKKLSREYGWAALGVYLLLSAMDFPFCFIAVRHLGAERIGHYEHVVVET
FT                   VKGLFGAKSAPEEQSQEEVSAPRPVQQTTEAQKKNNGDGPSLWTQLALAYAVHKSLIFI
FT                   RVPLTAAITPKVVKVLRVWGWDLAKRRPRGM"
     MSLKFITTPR WFSHLIGQAG HAPSLSFVRK NVTSSQGLFT PNIVASFPSR RAFASSPAWK        60
     SNPQYRFFPR QSGSTTTFTY NPPSTLQRSI FRRFNSSRAN QSARPAESGS LSQRLKKLSR       120
     EYGWAALGVY LLLSAMDFPF CFIAVRHLGA ERIGHYEHVV VETVKGLFGA KSAPEEQSQE       180
     EVSAPRPVQQ TTEAQKKNNG DGPSLWTQLA LAYAVHKSLI FIRVPLTAAI TPKVVKVLRV       240
     WGWDLAKRRP RGM                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page