(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE387

ASFUM1_4.PE387       Location/Qualifiers
FT   CDS             join(complement(1531738..1531747),
FT                   complement(1530440..1531647))
FT                   /codon_start=1
FT                   /gene_family="HOG000187686" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260064"
FT                   /orf_name="AFUA_4G06030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90183.1"
FT                   /db_xref="HOGENOM:HBG054271"
FT                   /db_xref="UniParc:UPI00005207D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK1"
FT                   /transl_table=1
FT                   /translation="MASGTAQAAPTSVNANGGTLAQTTAEQTPIPPTTSEPTSTPSTTS
FT                   STTSTTSTPPEPPTTSSTSSTSTSSTSSTSSTTTAQITEPTTSETSRSPDDVTTTIATA
FT                   SPTNTNTGPTTVYVTSTESTRQTLPTGNSANGVTTTSSGPSATASSTGGSSGGSGLSAG
FT                   GTIAVAVVVPVVSVALIILAALYFWRKWKAKKAAEEERRKEVEEYGFNPNNDPTLPPIM
FT                   GAGAAYEPKEDTSGYRGWGTTSAGRKASTNLSSGAGPGLAISEAGSAPGYHHAATPSDG
FT                   TIQFSEGQMQETEPIGVLGAAPTSSNNRTTDIHRGPSNASSAYSAANRSEASEESHMSG
FT                   THPAAAFYEDNPYYSDMQGQYGAYGDGPYVPNQPVIRDVQARRNTRIENPAVFPRQGNA
FT                   GIAQNF"
     MASGTAQAAP TSVNANGGTL AQTTAEQTPI PPTTSEPTST PSTTSSTTST TSTPPEPPTT        60
     SSTSSTSTSS TSSTSSTTTA QITEPTTSET SRSPDDVTTT IATASPTNTN TGPTTVYVTS       120
     TESTRQTLPT GNSANGVTTT SSGPSATASS TGGSSGGSGL SAGGTIAVAV VVPVVSVALI       180
     ILAALYFWRK WKAKKAAEEE RRKEVEEYGF NPNNDPTLPP IMGAGAAYEP KEDTSGYRGW       240
     GTTSAGRKAS TNLSSGAGPG LAISEAGSAP GYHHAATPSD GTIQFSEGQM QETEPIGVLG       300
     AAPTSSNNRT TDIHRGPSNA SSAYSAANRS EASEESHMSG THPAAAFYED NPYYSDMQGQ       360
     YGAYGDGPYV PNQPVIRDVQ ARRNTRIENP AVFPRQGNAG IAQNF                       405
//

If you have problems or comments...

PBIL Back to PBIL home page