(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE39

ASFUM1_4.PE39        Location/Qualifiers
FT   CDS             join(129266..129397,129444..131133,131190..132478)
FT                   /codon_start=1
FT                   /gene_family="HOG000216777" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19905470"
FT                   /orf_name="AFUA_4G00500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84368.2"
FT                   /db_xref="HOGENOM:HBG054116"
FT                   /db_xref="UniParc:UPI0000F51C16"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W973"
FT                   /transl_table=1
FT                   /translation="MQFSRAICLVCIAAYSPVLSAVLAEDVTVTETVLETVTVSEPWEA
FT                   ATSLPTSATAYSAVAETSTSPAELRLDTPTVLLPTSSSAYWLIPGPSPILGAETSTSTT
FT                   ITPPAYTLRKRANPPKSPAIIARAPATITVTSTSTVTTCPVCTNTPTTTSTNTPTITPP
FT                   ETTPTTSTITSTPVTTPTVGPGSTVTTTVTVTTTAPGPTETDTVTTTVGLPGTTETDTL
FT                   TSTVTIPGTTGTDTVTTTIDLPGATVTATQSSTSTITITATTTQSGTTCAATPGDGITQ
FT                   TTTVTVSSEGATTMTLTQTVTLPATTVSNAATLTEATSVAMSGFTLTVPGSTVTETTTS
FT                   TKITTQTVTVSGSTVTGITTVTRTSTSTVTSPGSTVTGTTTLTKISTSTLTSLGVTVTD
FT                   TMPVTEGSIQTISQILTMTAIKTEVLPGTTVVDSKTITLPGTTIVNSKAVTLTVPGTTV
FT                   TTMRTITKSGTTMTISEVVTLPGSTVTTIETVPTTLSGSIIVTTTTKPGQTITMSGSVT
FT                   TLPGSTIIQSSTLPSVTTTDLQVIPTTLPGAMILTTVMRPASTMIVSGTITTLPGSTIV
FT                   QSATLPGLRLVETVSVTVIQSTTIFDTVTLTGFDKTITTTEPAASTAQSGNTVTVPTTT
FT                   TTLFICPTLSINPTYTPVAPLPRNYTWGCPPGYLCKTKHTGADAGCNIEASMPAESYVC
FT                   SPDECIKSPPFIHDQYWGTPVESNEIRSSYNISKDYFNLDPEIFGLNYSIFRIPDLKPG
FT                   DDHYYIRSSRRTWSKLLARQSIGVSTVPGACYDECNDAALEVESTGKTPDICNAGSAFN
FT                   VSLGQCEKCCNTHKTATSASFEQKVLPNFQQFLNFCEGLEDSATTAAADTVGSTTKGSQ
FT                   TSTTPGTTSTQEGGTMSQADPLTASSTSNFTGKATKSRDKSSTAASATSIEQTIIPSPT
FT                   QQTTAPHPMTESKPVTASEISTDTISSSSSCSATGTSSRETAQSSSASENTGNSAATST
FT                   SHRPTSTHSGASPSAPALLFTGAASLQTVPSHWGILAFIFGVVGFHI"
     MQFSRAICLV CIAAYSPVLS AVLAEDVTVT ETVLETVTVS EPWEAATSLP TSATAYSAVA        60
     ETSTSPAELR LDTPTVLLPT SSSAYWLIPG PSPILGAETS TSTTITPPAY TLRKRANPPK       120
     SPAIIARAPA TITVTSTSTV TTCPVCTNTP TTTSTNTPTI TPPETTPTTS TITSTPVTTP       180
     TVGPGSTVTT TVTVTTTAPG PTETDTVTTT VGLPGTTETD TLTSTVTIPG TTGTDTVTTT       240
     IDLPGATVTA TQSSTSTITI TATTTQSGTT CAATPGDGIT QTTTVTVSSE GATTMTLTQT       300
     VTLPATTVSN AATLTEATSV AMSGFTLTVP GSTVTETTTS TKITTQTVTV SGSTVTGITT       360
     VTRTSTSTVT SPGSTVTGTT TLTKISTSTL TSLGVTVTDT MPVTEGSIQT ISQILTMTAI       420
     KTEVLPGTTV VDSKTITLPG TTIVNSKAVT LTVPGTTVTT MRTITKSGTT MTISEVVTLP       480
     GSTVTTIETV PTTLSGSIIV TTTTKPGQTI TMSGSVTTLP GSTIIQSSTL PSVTTTDLQV       540
     IPTTLPGAMI LTTVMRPAST MIVSGTITTL PGSTIVQSAT LPGLRLVETV SVTVIQSTTI       600
     FDTVTLTGFD KTITTTEPAA STAQSGNTVT VPTTTTTLFI CPTLSINPTY TPVAPLPRNY       660
     TWGCPPGYLC KTKHTGADAG CNIEASMPAE SYVCSPDECI KSPPFIHDQY WGTPVESNEI       720
     RSSYNISKDY FNLDPEIFGL NYSIFRIPDL KPGDDHYYIR SSRRTWSKLL ARQSIGVSTV       780
     PGACYDECND AALEVESTGK TPDICNAGSA FNVSLGQCEK CCNTHKTATS ASFEQKVLPN       840
     FQQFLNFCEG LEDSATTAAA DTVGSTTKGS QTSTTPGTTS TQEGGTMSQA DPLTASSTSN       900
     FTGKATKSRD KSSTAASATS IEQTIIPSPT QQTTAPHPMT ESKPVTASEI STDTISSSSS       960
     CSATGTSSRE TAQSSSASEN TGNSAATSTS HRPTSTHSGA SPSAPALLFT GAASLQTVPS      1020
     HWGILAFIFG VVGFHI                                                      1036
//

If you have problems or comments...

PBIL Back to PBIL home page