(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE390

ASFUM1_4.PE390       Location/Qualifiers
FT   CDS             complement(1543244..1546048)
FT                   /codon_start=1
FT                   /gene_family="HOG000187708" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750023"
FT                   /orf_name="AFUA_4G06060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90180.1"
FT                   /db_xref="HOGENOM:HBG054267"
FT                   /db_xref="HOGENOM:HBG324374"
FT                   /db_xref="UniParc:UPI000051F026"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK4"
FT                   /transl_table=1
FT                   /translation="MTSPPSHLKEENDTPSHSRRPSSSWLRRLSIQPQESRLSNNGPLS
FT                   PSSNDPTSPGLSRPSSQRRVPNKLVKRPPSQHSSGLPLSSHAPSSPWAPSQLRRPATSY
FT                   QRSEVLRHRATHSLNFEPSSITGPASHSVEAGASIDIEEGAWQPYLRPSLEGVTERLAR
FT                   RLSTVTRPKEQTLRRILPSPDALPALLLATSITVKEPAINITSNEFAPASPVQFRDPFK
FT                   LDDPPHARDAPSVVESNSGPSSIVLEADPRSPEKGSSAAASKQSNSGPPVWSRRRAAST
FT                   SFSELPNSKAATSVSRRLHGKRNITDPNIFRRPPDTFKAGYPNFLTAKIMRSRRSVTPS
FT                   YLREYRAELGRCRDYGNRPLTSDAIALSASQNAFFRASDLTFLWSVRQRPRRHSIAASD
FT                   PASSAIGSEDTRIFTSGDEDESDFLTDTAFDSIRTHFTIGSISGSRGLRIETMFDKNSV
FT                   ESLANHEITIEALEPRGPRMPDGLTSAKCDMGIDSDAVSGSTPRTREIAELDDSEDNRI
FT                   SFPSDLSEDEDARSTVAALPGETNSPFIFPRSPLVASNFYPEGNDIRAHVHSNSSHASD
FT                   EAFALDELRSVSQESLGSCRKMNIFDWSEQSRSDRDASRIDERPRTVHGKNGPEFRGSR
FT                   APGRRAPNSLHLRSQSVPVAREPATASESRQTSGKFGTWGLGSKGVSEDWDSDFEFDDA
FT                   EVDNENMRPSRTSSRRGMIVPAAILERQASLHGQFGQVQELTLLVEELKRLRHRASFLN
FT                   IVQGPSSELWQEAEGIVNLATLDDEENNDSPPRSPTSLTFSFDDSEGESSNLADPSKRT
FT                   SGDSWRASLSEKLPPNLNISCDTSAKAKSVLDLIYQQRSQDPALRGPHCSRSKKLPFDT
FT                   QSLRDLVIRAGVVTRALKEVIRKEEGVITTPDDKAQSSDLPFSRIFDQPTDDNHLIYET
FT                   HCVN"
     MTSPPSHLKE ENDTPSHSRR PSSSWLRRLS IQPQESRLSN NGPLSPSSND PTSPGLSRPS        60
     SQRRVPNKLV KRPPSQHSSG LPLSSHAPSS PWAPSQLRRP ATSYQRSEVL RHRATHSLNF       120
     EPSSITGPAS HSVEAGASID IEEGAWQPYL RPSLEGVTER LARRLSTVTR PKEQTLRRIL       180
     PSPDALPALL LATSITVKEP AINITSNEFA PASPVQFRDP FKLDDPPHAR DAPSVVESNS       240
     GPSSIVLEAD PRSPEKGSSA AASKQSNSGP PVWSRRRAAS TSFSELPNSK AATSVSRRLH       300
     GKRNITDPNI FRRPPDTFKA GYPNFLTAKI MRSRRSVTPS YLREYRAELG RCRDYGNRPL       360
     TSDAIALSAS QNAFFRASDL TFLWSVRQRP RRHSIAASDP ASSAIGSEDT RIFTSGDEDE       420
     SDFLTDTAFD SIRTHFTIGS ISGSRGLRIE TMFDKNSVES LANHEITIEA LEPRGPRMPD       480
     GLTSAKCDMG IDSDAVSGST PRTREIAELD DSEDNRISFP SDLSEDEDAR STVAALPGET       540
     NSPFIFPRSP LVASNFYPEG NDIRAHVHSN SSHASDEAFA LDELRSVSQE SLGSCRKMNI       600
     FDWSEQSRSD RDASRIDERP RTVHGKNGPE FRGSRAPGRR APNSLHLRSQ SVPVAREPAT       660
     ASESRQTSGK FGTWGLGSKG VSEDWDSDFE FDDAEVDNEN MRPSRTSSRR GMIVPAAILE       720
     RQASLHGQFG QVQELTLLVE ELKRLRHRAS FLNIVQGPSS ELWQEAEGIV NLATLDDEEN       780
     NDSPPRSPTS LTFSFDDSEG ESSNLADPSK RTSGDSWRAS LSEKLPPNLN ISCDTSAKAK       840
     SVLDLIYQQR SQDPALRGPH CSRSKKLPFD TQSLRDLVIR AGVVTRALKE VIRKEEGVIT       900
     TPDDKAQSSD LPFSRIFDQP TDDNHLIYET HCVN                                   934
//

If you have problems or comments...

PBIL Back to PBIL home page