(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE394

ASFUM1_4.PE394       Location/Qualifiers
FT   CDS             join(complement(1559933..1560087),
FT                   complement(1559835..1559865),complement(1559348..1559757),
FT                   complement(1558962..1559286))
FT                   /codon_start=1
FT                   /gene_family="HOG000216895" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19055338"
FT                   /gene_name="sec13"
FT                   /orf_name="AFUA_4G06090"
FT                   /product="Protein transport protein sec13 "
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="ER to Golgi transport vesicle membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="EAL90177.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0012507"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054264"
FT                   /db_xref="HOGENOM:HBG590901"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0000520555"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNK7"
FT                   /transl_table=1
FT                   /translation="MTRGTNLVGPFLQHDAGLDYYGRRLATCSSDKTIKIFEIEGETHR
FT                   LIETLKGHEGAVWCVAWAHPKFGTILASSSYDGKVLIWREQHQNATSPVAGSTWTKVFD
FT                   FSLHTASVNMVSWAPHESGCLLACASSDGHVSVLEFRDNSWTHQIFHAHGMGVNSISWA
FT                   PAASPGSLISSNPGPGQQRRFVTGGSDNLLKIWDYNPESKTYNLSQTLEGHSDWVRDVA
FT                   WSPSILSKSYIASASQDKTVRIWTSDASNPGQWTSQQLEFDTVLWRVSWSPSGNILAVS
FT                   GGDNKVSLWKENLKGQWEKVKDIEE"
     MTRGTNLVGP FLQHDAGLDY YGRRLATCSS DKTIKIFEIE GETHRLIETL KGHEGAVWCV        60
     AWAHPKFGTI LASSSYDGKV LIWREQHQNA TSPVAGSTWT KVFDFSLHTA SVNMVSWAPH       120
     ESGCLLACAS SDGHVSVLEF RDNSWTHQIF HAHGMGVNSI SWAPAASPGS LISSNPGPGQ       180
     QRRFVTGGSD NLLKIWDYNP ESKTYNLSQT LEGHSDWVRD VAWSPSILSK SYIASASQDK       240
     TVRIWTSDAS NPGQWTSQQL EFDTVLWRVS WSPSGNILAV SGGDNKVSLW KENLKGQWEK       300
     VKDIEE                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page