(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE396

ASFUM1_4.PE396       Location/Qualifiers
FT   CDS             join(1563138..1563818,1563891..1563935)
FT                   /codon_start=1
FT                   /gene_family="HOG000187741" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750025"
FT                   /orf_name="AFUA_4G06110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90175.2"
FT                   /db_xref="HOGENOM:HBG054262"
FT                   /db_xref="HOGENOM:HBG324371"
FT                   /db_xref="UniParc:UPI0000F51BCC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNK9"
FT                   /transl_table=1
FT                   /translation="MLLCLYRNMLPPSDSFLHHSHKLREVAANARNRAVRIPPPPYSLA
FT                   VPRGSTHEEGQNALETIDDDTAWETCAGASSTPITISIDASINVVGNGNTIMIPSMAGH
FT                   PQQTPKVSSSMSPESSSSSSSIAPAASEADTLHSIQKQRQARLTEMATAIINTLYDSGR
FT                   LAPPAEDHEHAPLEIKINTGIKVEGSRNVICVGATARAQSNKSAPMGTDKDRQVILNRK
FT                   RRALSEPFEAPNSKKNCVQ"
     MLLCLYRNML PPSDSFLHHS HKLREVAANA RNRAVRIPPP PYSLAVPRGS THEEGQNALE        60
     TIDDDTAWET CAGASSTPIT ISIDASINVV GNGNTIMIPS MAGHPQQTPK VSSSMSPESS       120
     SSSSSIAPAA SEADTLHSIQ KQRQARLTEM ATAIINTLYD SGRLAPPAED HEHAPLEIKI       180
     NTGIKVEGSR NVICVGATAR AQSNKSAPMG TDKDRQVILN RKRRALSEPF EAPNSKKNCV       240
     Q                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page