(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE397

ASFUM1_4.PE397       Location/Qualifiers
FT   CDS             join(complement(1566441..1566784),
FT                   complement(1565180..1566352),complement(1565031..1565115),
FT                   complement(1564873..1564971))
FT                   /codon_start=1
FT                   /gene_family="HOG000187752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902017"
FT                   /orf_name="AFUA_4G06120"
FT                   /product="RSC complex subunit Sfh1, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin remodeling"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nuclear chromosome"
FT                   /protein_id="EAL90174.1"
FT                   /db_xref="GO:0000228"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006338"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG054261"
FT                   /db_xref="HOGENOM:HBG324370"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI000051F50A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL0"
FT                   /transl_table=1
FT                   /translation="MSPLRGYITSYPPRIRQYGNALLTPVIPQTQVGPTPRTTKRGTTA
FT                   VNYAEDGFDDDDFEDSEGPRRPTGLRSLRREESATDKTPLAEKLGKEIHAPVEVQGVFR
FT                   DWMIKRMLRPACADQLQIQAQLPLTLIPIRIDLEVPAHQPLEPFPMPRGVVDPGINPTL
FT                   PGYRRPDPLPAFRIKDTFLWNLHEALATPEEFAMGFVRDLDLPNPQAMTLAISNQIRQQ
FT                   LEEYAGVALHPLFQSTQSSKPAPTSQTNPSRDVSATPVPTQAATPDNRAIGVSVTKEAL
FT                   VNDSILNPDDAYRCLINLNINLQNRLYTDKFEWSLLHPPGMAEEFAQVTCADLGLGGEW
FT                   VGAIAHGIYEAVLKLKKEVCESGGMISGMGGYGNEIDNQAANGTEAGWRYDPEGLGDEW
FT                   EPKVETLSKEEIEKREGDRERQIRRLRRETARFSSTAGITPDMSRQGSGYFDVDSETPL
FT                   GRGERSKRKRRFRSLSPSGRGGTPGGRGTPDTGSGAGYGGGGGTLSDWERQSWRCSNCM
FT                   VWGSAVWAVRDGPAGPRTLCHNCGLLYERDKVTPEWSRDLHRHDVPVGR"
     MSPLRGYITS YPPRIRQYGN ALLTPVIPQT QVGPTPRTTK RGTTAVNYAE DGFDDDDFED        60
     SEGPRRPTGL RSLRREESAT DKTPLAEKLG KEIHAPVEVQ GVFRDWMIKR MLRPACADQL       120
     QIQAQLPLTL IPIRIDLEVP AHQPLEPFPM PRGVVDPGIN PTLPGYRRPD PLPAFRIKDT       180
     FLWNLHEALA TPEEFAMGFV RDLDLPNPQA MTLAISNQIR QQLEEYAGVA LHPLFQSTQS       240
     SKPAPTSQTN PSRDVSATPV PTQAATPDNR AIGVSVTKEA LVNDSILNPD DAYRCLINLN       300
     INLQNRLYTD KFEWSLLHPP GMAEEFAQVT CADLGLGGEW VGAIAHGIYE AVLKLKKEVC       360
     ESGGMISGMG GYGNEIDNQA ANGTEAGWRY DPEGLGDEWE PKVETLSKEE IEKREGDRER       420
     QIRRLRRETA RFSSTAGITP DMSRQGSGYF DVDSETPLGR GERSKRKRRF RSLSPSGRGG       480
     TPGGRGTPDT GSGAGYGGGG GTLSDWERQS WRCSNCMVWG SAVWAVRDGP AGPRTLCHNC       540
     GLLYERDKVT PEWSRDLHRH DVPVGR                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page