(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE398

ASFUM1_4.PE398       Location/Qualifiers
FT   CDS             join(complement(1568815..1568893),
FT                   complement(1568673..1568709),complement(1568472..1568607),
FT                   complement(1568054..1568403),complement(1567735..1567999),
FT                   complement(1567665..1567685))
FT                   /codon_start=1
FT                   /gene_family="HOG000187763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260067"
FT                   /orf_name="AFUA_4G06130"
FT                   /product="General stress response protein Whi2, putative "
FT                   /protein_id="EAL90173.2"
FT                   /db_xref="HOGENOM:HBG054260"
FT                   /db_xref="HOGENOM:HBG324369"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniParc:UPI0000F51BB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL1"
FT                   /transl_table=1
FT                   /translation="MAAAGGPSSIITQVQQAGGPPINTLGDIGCDEHITLELRGTRFTL
FT                   SRDELLTLPEFVLLSLFPNGLLPDGHMGSFQEGDIYPVDYDPTSLQYMLDFFRSVAQSI
FT                   PSSSPSASTTPELEMSETVLGSPRDILQDRAGIIVLREDLDFYAIPPRPDIDHTEMMEV
FT                   KRAVGKALLKQDGIFSGLKKSDEPGSTEQHLIEMLTAGGFERDDRWGHRAPEPNKAVIC
FT                   SLALAKLRTDVRGDLSNNNAVGMAQKLLLFWRKPARRCWWEGVELESVEGVEGKVKVWI
FT                   RRVWTLEMSVIGLR"
     MAAAGGPSSI ITQVQQAGGP PINTLGDIGC DEHITLELRG TRFTLSRDEL LTLPEFVLLS        60
     LFPNGLLPDG HMGSFQEGDI YPVDYDPTSL QYMLDFFRSV AQSIPSSSPS ASTTPELEMS       120
     ETVLGSPRDI LQDRAGIIVL REDLDFYAIP PRPDIDHTEM MEVKRAVGKA LLKQDGIFSG       180
     LKKSDEPGST EQHLIEMLTA GGFERDDRWG HRAPEPNKAV ICSLALAKLR TDVRGDLSNN       240
     NAVGMAQKLL LFWRKPARRC WWEGVELESV EGVEGKVKVW IRRVWTLEMS VIGLR            295
//

If you have problems or comments...

PBIL Back to PBIL home page