(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE40

ASFUM1_4.PE40        Location/Qualifiers
FT   CDS             join(complement(134458..135102),complement(133477..134406))
FT                   /codon_start=1
FT                   /gene_family="HOG000048673" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18210060"
FT                   /orf_name="AFUA_4G00510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84367.1"
FT                   /db_xref="HOGENOM:HBG054105"
FT                   /db_xref="HOGENOM:HBG324265"
FT                   /db_xref="UniParc:UPI000051E8D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W974"
FT                   /transl_table=1
FT                   /translation="MSASAKGRGEKSFRSSLSALESAAKDVLSFTKNITTVDDLQRQKS
FT                   DLQCQLDDAGVKIRELQESLNYEKRRNDDNFLKVEQLASGWAKKKTSLEARVREVADSS
FT                   QSATKKKMEDLEQRTKGAEEDMLQCQRRLDEQIMKNRKLQTMLEESDFRLKTLNHDIAV
FT                   GEVDLDEYGNQSIICELIFLLSGSLRKGFQSMEKRLKALSAKFFKSSTSTEPSRARENT
FT                   EHIQTSNYSPRSQSIIPFPFANITCPREVLAQSIIANRLSTDILTPVCLPSPMGRMGIG
FT                   EALERSSGIRPRQKAILRSLLVTAFESEEVRLRNELLITAVSDISHELQSLLQSREMQT
FT                   FKQELQEFFVFAANVWKPVQRSQRWIRATSDLRSCPPHHWRDSERRTTSDFPLSSGSPS
FT                   LVLFPHIFDVDEEEPLYHGLVWCVKSNFKDTAEKPSCIPPRLQGAEEHAWNETSTGTGP
FT                   VIQVDSTQMKGSSEQLDAGRNYLERTGEGSISSNGEGATLKTHKCRANGRETRRSVALK
FT                   SVPTGGL"
     MSASAKGRGE KSFRSSLSAL ESAAKDVLSF TKNITTVDDL QRQKSDLQCQ LDDAGVKIRE        60
     LQESLNYEKR RNDDNFLKVE QLASGWAKKK TSLEARVREV ADSSQSATKK KMEDLEQRTK       120
     GAEEDMLQCQ RRLDEQIMKN RKLQTMLEES DFRLKTLNHD IAVGEVDLDE YGNQSIICEL       180
     IFLLSGSLRK GFQSMEKRLK ALSAKFFKSS TSTEPSRARE NTEHIQTSNY SPRSQSIIPF       240
     PFANITCPRE VLAQSIIANR LSTDILTPVC LPSPMGRMGI GEALERSSGI RPRQKAILRS       300
     LLVTAFESEE VRLRNELLIT AVSDISHELQ SLLQSREMQT FKQELQEFFV FAANVWKPVQ       360
     RSQRWIRATS DLRSCPPHHW RDSERRTTSD FPLSSGSPSL VLFPHIFDVD EEEPLYHGLV       420
     WCVKSNFKDT AEKPSCIPPR LQGAEEHAWN ETSTGTGPVI QVDSTQMKGS SEQLDAGRNY       480
     LERTGEGSIS SNGEGATLKT HKCRANGRET RRSVALKSVP TGGL                        524
//

If you have problems or comments...

PBIL Back to PBIL home page