(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE402

ASFUM1_4.PE402       Location/Qualifiers
FT   CDS             join(1585417..1585591,1585658..1586220,1586301..1586432)
FT                   /codon_start=1
FT                   /gene_family="HOG000187797" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260069"
FT                   /orf_name="AFUA_4G06170"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="EAL90169.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG054255"
FT                   /db_xref="HOGENOM:HBG324366"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniParc:UPI0000F51C32"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL5"
FT                   /transl_table=1
FT                   /translation="MHRSSNNSYHQSSSSRSSSAHSSSSAFSPNANPNEDWTKISDLAE
FT                   RRRIQNRIAQRNYRKKLKRRLEDLEKRAASASESPERSHEKPELPKHANPGKSSSRTSR
FT                   SSKSNLETSHGSRERLPLYDCYNSQDDRGAMFSHQCTRQLSASPPPVFSYPSYPHLDPY
FT                   RQSNYGTSPAYSSTYNDLSSFQGEYGNPVPSIMPVAMSSGGPLKRPHTYADEEIISPFS
FT                   MSYATMAGIDLCPTSHHPGESNISIPSLCQLFAEDLSSPPTPAETSILTCPLTPESDPC
FT                   SPHSFPFL"
     MHRSSNNSYH QSSSSRSSSA HSSSSAFSPN ANPNEDWTKI SDLAERRRIQ NRIAQRNYRK        60
     KLKRRLEDLE KRAASASESP ERSHEKPELP KHANPGKSSS RTSRSSKSNL ETSHGSRERL       120
     PLYDCYNSQD DRGAMFSHQC TRQLSASPPP VFSYPSYPHL DPYRQSNYGT SPAYSSTYND       180
     LSSFQGEYGN PVPSIMPVAM SSGGPLKRPH TYADEEIISP FSMSYATMAG IDLCPTSHHP       240
     GESNISIPSL CQLFAEDLSS PPTPAETSIL TCPLTPESDP CSPHSFPFL                   289
//

If you have problems or comments...

PBIL Back to PBIL home page