(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE404

ASFUM1_4.PE404       Location/Qualifiers
FT   CDS             join(complement(1594050..1594958),
FT                   complement(1593736..1593987),complement(1592712..1593680))
FT                   /codon_start=1
FT                   /gene_family="HOG000161576" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750027"
FT                   /orf_name="AFUA_4G06190"
FT                   /product="Fungal specific transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="protein kinase regulator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="protein kinase CK2 complex "
FT                   /protein_id="EAL90167.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005956"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0019887"
FT                   /db_xref="HOGENOM:HBG054253"
FT                   /db_xref="HOGENOM:HBG324365"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051ED90"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNL7"
FT                   /transl_table=1
FT                   /translation="MTFEFLWRENDCAIGRYAPNCCNNNFKDSEYVLSPLSLIWLTLLS
FT                   VRQLTSVVRDREFRSMKDQITTLQEQVNSLFTSLNDLRNQRSSLDSPNLEDLSRDGSQS
FT                   VFTSMHAATVRPRVRHLRFHGPTSSAFNFDVARSSLQTMGIAPAEEVMNDDMTTAQATP
FT                   AASPPAQQAVFTQSIHPTKDPIWAIKREEALRLCHVYEEEVGIMYPLVDIEKVTNQVNL
FT                   LYTFMEAALRTGFAQRAFPGPDSLLDDNTILLKMILAITLIVEGSGRSDLGQRLFLSVK
FT                   PIIEAKLWGPIDIKTIQLFGMVATYHFHTDDDAMAYRVIGFAARMCLELGLHRREALMK
FT                   SFPNEDQWADVTKVFWTIYSLDRRWSLGTGLPFVIQDEDVDPNLPEPDGSLPYLRCMIS
FT                   YNRISSKIWYSGLGSEGTTDIRRDEIGYLDYQVLQWYKQVPDALKFYPGDSPKHGETVS
FT                   RGLRRLRVLLYLRMNQLRILIYRPVLHSSASIAEDNGHAQTVVDVAKDTVRVLTQLNHT
FT                   SDIYRTQQITFNYFLVAALAVLFLAVCHAPNEFNRQVRDEFYMALDLINGFSTKSYVSK
FT                   RLWKTIKGLRMVGERLGVLARPFGSDSNDPHSTAAVAMAGLAGHSIENLSVYGPMNGVN
FT                   ELGNSPLNGLQMSQELTNLFEAVGGFSSFIASGTAPEGIPGFVNHDRELQNTGEGLSGI
FT                   FGDDGELSRIIRELF"
     MTFEFLWREN DCAIGRYAPN CCNNNFKDSE YVLSPLSLIW LTLLSVRQLT SVVRDREFRS        60
     MKDQITTLQE QVNSLFTSLN DLRNQRSSLD SPNLEDLSRD GSQSVFTSMH AATVRPRVRH       120
     LRFHGPTSSA FNFDVARSSL QTMGIAPAEE VMNDDMTTAQ ATPAASPPAQ QAVFTQSIHP       180
     TKDPIWAIKR EEALRLCHVY EEEVGIMYPL VDIEKVTNQV NLLYTFMEAA LRTGFAQRAF       240
     PGPDSLLDDN TILLKMILAI TLIVEGSGRS DLGQRLFLSV KPIIEAKLWG PIDIKTIQLF       300
     GMVATYHFHT DDDAMAYRVI GFAARMCLEL GLHRREALMK SFPNEDQWAD VTKVFWTIYS       360
     LDRRWSLGTG LPFVIQDEDV DPNLPEPDGS LPYLRCMISY NRISSKIWYS GLGSEGTTDI       420
     RRDEIGYLDY QVLQWYKQVP DALKFYPGDS PKHGETVSRG LRRLRVLLYL RMNQLRILIY       480
     RPVLHSSASI AEDNGHAQTV VDVAKDTVRV LTQLNHTSDI YRTQQITFNY FLVAALAVLF       540
     LAVCHAPNEF NRQVRDEFYM ALDLINGFST KSYVSKRLWK TIKGLRMVGE RLGVLARPFG       600
     SDSNDPHSTA AVAMAGLAGH SIENLSVYGP MNGVNELGNS PLNGLQMSQE LTNLFEAVGG       660
     FSSFIASGTA PEGIPGFVNH DRELQNTGEG LSGIFGDDGE LSRIIRELF                   709
//

If you have problems or comments...

PBIL Back to PBIL home page