(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE407

ASFUM1_4.PE407       Location/Qualifiers
FT   CDS             1599731..1600309
FT                   /codon_start=1
FT                   /gene_family="HOG000187819" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750029"
FT                   /orf_name="AFUA_4G06220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90164.1"
FT                   /db_xref="HOGENOM:HBG054250"
FT                   /db_xref="UniParc:UPI000051F28B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM0"
FT                   /transl_table=1
FT                   /translation="MYTSLKAISRATVLHISLNPLFLIGARASLATATTTSPNLRSYSA
FT                   LYPICPSFHLYYPTQISSIHNHNQGHPFSTSATMSAESASNESQSQHPRQPENEQEQDP
FT                   NKPILALPEAPSAESGATHIDVSGGGSTVKLDALGPLVVNQDGTLSRIANWEQMTEIER
FT                   RNTLRVLGKRNKLRLDSLKAAEGEKDESN"
     MYTSLKAISR ATVLHISLNP LFLIGARASL ATATTTSPNL RSYSALYPIC PSFHLYYPTQ        60
     ISSIHNHNQG HPFSTSATMS AESASNESQS QHPRQPENEQ EQDPNKPILA LPEAPSAESG       120
     ATHIDVSGGG STVKLDALGP LVVNQDGTLS RIANWEQMTE IERRNTLRVL GKRNKLRLDS       180
     LKAAEGEKDE SN                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page