(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE408

ASFUM1_4.PE408       Location/Qualifiers
FT   CDS             join(complement(1602693..1603023),
FT                   complement(1601898..1602120),complement(1601087..1601822),
FT                   complement(1600632..1601012))
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055340"
FT                   /orf_name="AFUA_4G06230"
FT                   /product="General amino acid permease (Agp2), putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL90163.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG054249"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051FE9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM1"
FT                   /transl_table=1
FT                   /translation="MSRPDPDTSVHQTSLPTAISSDRSSHLADDFNLATANLTKRNGCP
FT                   ITYSEKATVVEDGEESIGGTLSKPTFDHTHRKLKPRHIQLIGIGGTIGTALYVQVGKSL
FT                   MKGGPGSLAEMVIYLPISSPFIRFAGRYVDEAFGVAAGYNFFVFEAALVPFEITACNMI
FT                   INYWSDVIPVSGVIVIVLVLYILLNVFAVQWYGESEFWLALSKVLLSIGLILFTFIVML
FT                   GGNPKGDRFGFRYWNEPGAFAEYYKTGDLGRWLGFLACLIQASFTIAGPDYVSMAAGEA
FT                   ANPRGVLPRTYNGIFYRLTAFFVLGVLCIGILVPYNDPTLAEAFAKGLPGAAASPYVVA
FT                   MDRLGIPILPHIVNAMILLAAFSAGNSYVYCASRSLYGLALDGKAPRLFTKCTKRGVPI
FT                   YCVTVVMLIALLAFLQVSNSASVVLDWFVNLVTASQLINFSVVTFTYTRFWKAMIAQGI
FT                   PRESLPYKSWWQPYTAYVALVSTTVMTFVGGYTVFLPGNWDIPTFLFSYTMIGVFPVLY
FT                   FGWKIVHRTQVKKPEEVDLLTGLDEIDEYERHYVPEKPR"
     MSRPDPDTSV HQTSLPTAIS SDRSSHLADD FNLATANLTK RNGCPITYSE KATVVEDGEE        60
     SIGGTLSKPT FDHTHRKLKP RHIQLIGIGG TIGTALYVQV GKSLMKGGPG SLAEMVIYLP       120
     ISSPFIRFAG RYVDEAFGVA AGYNFFVFEA ALVPFEITAC NMIINYWSDV IPVSGVIVIV       180
     LVLYILLNVF AVQWYGESEF WLALSKVLLS IGLILFTFIV MLGGNPKGDR FGFRYWNEPG       240
     AFAEYYKTGD LGRWLGFLAC LIQASFTIAG PDYVSMAAGE AANPRGVLPR TYNGIFYRLT       300
     AFFVLGVLCI GILVPYNDPT LAEAFAKGLP GAAASPYVVA MDRLGIPILP HIVNAMILLA       360
     AFSAGNSYVY CASRSLYGLA LDGKAPRLFT KCTKRGVPIY CVTVVMLIAL LAFLQVSNSA       420
     SVVLDWFVNL VTASQLINFS VVTFTYTRFW KAMIAQGIPR ESLPYKSWWQ PYTAYVALVS       480
     TTVMTFVGGY TVFLPGNWDI PTFLFSYTMI GVFPVLYFGW KIVHRTQVKK PEEVDLLTGL       540
     DEIDEYERHY VPEKPR                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page