(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE413

ASFUM1_4.PE413       Location/Qualifiers
FT   CDS             1612277..1613176
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055341"
FT                   /orf_name="AFUA_4G06280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90158.1"
FT                   /db_xref="HOGENOM:HBG054243"
FT                   /db_xref="UniParc:UPI00005200C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM6"
FT                   /transl_table=1
FT                   /translation="MVWLTLHRVDISCAPKAIYTSCLPWTGTVPDTSPESLDFLAPDVH
FT                   LAIPPTQTAVGSFDSLCDQNRACEDFLRFFRCLHELEKAALGCPGTVSRSSPASRVRRF
FT                   TPGAPLHSILTMLPDYDHGIRDIRFIDEYTCMSCLFFLAVALYDSYRNSTNFDRYLDWL
FT                   DMEVQRLSPSTKPSITSVLWIFLNNGGYPQGEAGDAGERCWVVSRMVRIAKRLEWKRQG
FT                   TIWDRLRQVLINFIFAQQECALGSDSVDEEAFIARQQRRRQSNEYFWDEDEMRVELLGS
FT                   QPSSVLTPYPQLQTTTVA"
     MVWLTLHRVD ISCAPKAIYT SCLPWTGTVP DTSPESLDFL APDVHLAIPP TQTAVGSFDS        60
     LCDQNRACED FLRFFRCLHE LEKAALGCPG TVSRSSPASR VRRFTPGAPL HSILTMLPDY       120
     DHGIRDIRFI DEYTCMSCLF FLAVALYDSY RNSTNFDRYL DWLDMEVQRL SPSTKPSITS       180
     VLWIFLNNGG YPQGEAGDAG ERCWVVSRMV RIAKRLEWKR QGTIWDRLRQ VLINFIFAQQ       240
     ECALGSDSVD EEAFIARQQR RRQSNEYFWD EDEMRVELLG SQPSSVLTPY PQLQTTTVA        299
//

If you have problems or comments...

PBIL Back to PBIL home page