(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE414

ASFUM1_4.PE414       Location/Qualifiers
FT   CDS             join(complement(1615463..1615615),
FT                   complement(1615009..1615362),complement(1614659..1614946),
FT                   complement(1613988..1614596))
FT                   /codon_start=1
FT                   /gene_family="HOG000187874" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260073"
FT                   /orf_name="AFUA_4G06290"
FT                   /product="Longevity-assurance protein (LAC1), putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL90157.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG054242"
FT                   /db_xref="HOGENOM:HBG324357"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="InterPro:IPR013599"
FT                   /db_xref="InterPro:IPR016439"
FT                   /db_xref="UniParc:UPI000051E459"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM7"
FT                   /transl_table=1
FT                   /translation="MAKDESTRSQSVSELNTCVSTSHRTAAKDATFREWMDANQIGMRL
FT                   FSNLPWSWTRWLTVALYAYLGVSLTILGTLLAAHNLYPTLRPYTAPFFELSYYQPSEGV
FT                   YVQGFDDVYFVVSSAITFTAVRAIAIEWIFRPAARYAGLKRKASNRFAEQAWMWMYYAF
FT                   FWTFGMYIWTNSYYWMDFKAIWAQWPARGISANLKWYLLAQLSFWFQQILVINMEERRK
FT                   DHYQMLTHHIITSTLLTSAYIYGFYNVSNVVLCLMDIVDLLLPTAKILKYFKFELCCNI
FT                   TFGLFMVTWLITRHIFYPLLCWSIYKDVPDAMAYGCYSGSTAEMISTDGYPNRFRYLFN
FT                   PFLDINGPICMNRTVKWIFLGFLLALQLLSLIWFVMVVRVAVNVLRTGNAEDTRSDGEE
FT                   EEEEVEVRPVGKDALNNNPVGVDGANADWRRASSGSASVRPRARGRIPLGDQSDRKALL
FT                   GRIGCDKPT"
     MAKDESTRSQ SVSELNTCVS TSHRTAAKDA TFREWMDANQ IGMRLFSNLP WSWTRWLTVA        60
     LYAYLGVSLT ILGTLLAAHN LYPTLRPYTA PFFELSYYQP SEGVYVQGFD DVYFVVSSAI       120
     TFTAVRAIAI EWIFRPAARY AGLKRKASNR FAEQAWMWMY YAFFWTFGMY IWTNSYYWMD       180
     FKAIWAQWPA RGISANLKWY LLAQLSFWFQ QILVINMEER RKDHYQMLTH HIITSTLLTS       240
     AYIYGFYNVS NVVLCLMDIV DLLLPTAKIL KYFKFELCCN ITFGLFMVTW LITRHIFYPL       300
     LCWSIYKDVP DAMAYGCYSG STAEMISTDG YPNRFRYLFN PFLDINGPIC MNRTVKWIFL       360
     GFLLALQLLS LIWFVMVVRV AVNVLRTGNA EDTRSDGEEE EEEVEVRPVG KDALNNNPVG       420
     VDGANADWRR ASSGSASVRP RARGRIPLGD QSDRKALLGR IGCDKPT                     467
//

If you have problems or comments...

PBIL Back to PBIL home page