(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE415

ASFUM1_4.PE415       Location/Qualifiers
FT   CDS             join(complement(1618003..1618031),
FT                   complement(1616828..1617947))
FT                   /codon_start=1
FT                   /gene_family="HOG000187885" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260074"
FT                   /orf_name="AFUA_4G06300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90156.1"
FT                   /db_xref="HOGENOM:HBG054241"
FT                   /db_xref="HOGENOM:HBG324356"
FT                   /db_xref="UniParc:UPI0000520307"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNM8"
FT                   /transl_table=1
FT                   /translation="MVELGISFATIKSLLIFFAPVIIPRAINLYRSLRVAVASRPTPRP
FT                   LPQATRRALNVLFFAILLCFLLSLPFNPHAPSPSIFTLTRSRINTPTDVIFSRLARFRP
FT                   DNTLSETDHLLRSKFTSVVARRVYLRYGPDALTSCEYCSLDNLKTYLLYYLPFNTLIPH
FT                   ILHMVLVGLVTSAPFAGREAASWRNKFTVAGLALAAIDIYIVSTYDPVLSASAAVRAGM
FT                   VPPSSLYHQTTLLRPLVFAVFDGICALLIYVTATNRFFFTPPSQADQVDQLVSTSLTSL
FT                   AGASSKLHAVSVTRNAVVRDKVLKDRDDAYWRTVVAMGAGNTDGDASVAPSSIWEEEEV
FT                   VRAMSRAMAGQGGVDLAKLGVSAAEYVNGVTAGLDDVDPPER"
     MVELGISFAT IKSLLIFFAP VIIPRAINLY RSLRVAVASR PTPRPLPQAT RRALNVLFFA        60
     ILLCFLLSLP FNPHAPSPSI FTLTRSRINT PTDVIFSRLA RFRPDNTLSE TDHLLRSKFT       120
     SVVARRVYLR YGPDALTSCE YCSLDNLKTY LLYYLPFNTL IPHILHMVLV GLVTSAPFAG       180
     REAASWRNKF TVAGLALAAI DIYIVSTYDP VLSASAAVRA GMVPPSSLYH QTTLLRPLVF       240
     AVFDGICALL IYVTATNRFF FTPPSQADQV DQLVSTSLTS LAGASSKLHA VSVTRNAVVR       300
     DKVLKDRDDA YWRTVVAMGA GNTDGDASVA PSSIWEEEEV VRAMSRAMAG QGGVDLAKLG       360
     VSAAEYVNGV TAGLDDVDPP ER                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page