(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE428

ASFUM1_4.PE428       Location/Qualifiers
FT   CDS             join(complement(1644035..1644201),
FT                   complement(1643738..1643957))
FT                   /codon_start=1
FT                   /gene_family="HOG000048509" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055344"
FT                   /orf_name="AFUA_4G06430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90143.1"
FT                   /db_xref="HOGENOM:HBG054227"
FT                   /db_xref="UniParc:UPI000051F77E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP1"
FT                   /transl_table=1
FT                   /translation="MMDKGYLLRSEDASQGAEESGQGMMTCTCALQKTRSRRSVSNGVK
FT                   GQWATGRQFGPADEEMIDFPGFCGLFFGCTSGGDGYSGLAWRLRLTLTLTLTLTLTLGL
FT                   GLGLGLGLGLGLDPYNPPHSGGTE"
     MMDKGYLLRS EDASQGAEES GQGMMTCTCA LQKTRSRRSV SNGVKGQWAT GRQFGPADEE        60
     MIDFPGFCGL FFGCTSGGDG YSGLAWRLRL TLTLTLTLTL TLGLGLGLGL GLGLGLDPYN       120
     PPHSGGTE                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page