(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE429

ASFUM1_4.PE429       Location/Qualifiers
FT   CDS             complement(1646627..1648819)
FT                   /codon_start=1
FT                   /gene_family="HOG000188000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902021"
FT                   /orf_name="AFUA_4G06460"
FT                   /product="Pentafunctional AROM polypeptide, putative "
FT                   /EC_number="4.2.1.10"
FT                   /function="3-dehydroquinate dehydratase activity "
FT                   /protein_id="EAL90141.1"
FT                   /db_xref="GO:0003855"
FT                   /db_xref="HOGENOM:HBG054224"
FT                   /db_xref="HOGENOM:HBG324343"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000051F01A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP3"
FT                   /transl_table=1
FT                   /translation="MMQTAIHQPMAMTILADTAPSVTNNSASAPSPANGAHPPLATAVS
FT                   ANSAVAAAPPSVPADPPRTVVVVYRSGQDSIVHLVAEVLGKPWTTETSLSTLVTGSNAV
FT                   VVGILAAELARSLDECDPSTLIVINTHCVDDGSSPDEALTDRCDYEFLYSHSPFLRRDL
FT                   TRFLSLILGQTRPHEDLKTKTRTNFISTTFPDVHAALPNLDILSVGSDAVEIRVDLLVE
FT                   PSPQGVVSPVPSLRYVGQQVMLLRQHTELPIIFTTRCTKENGKFPMDDPMLFYRYLRRA
FT                   IQWGCEYIDVELWLPEEIRRRLAEQKGHSVIMSAFHDFSGTWKWTSPEAARIFAESARY
FT                   ADIVKMIAMVHTIEANYELEYFRSTVKARGAGDSSPLLSAVNMGQMGQLSRALNTVFSP
FT                   ITHPLLPMIAAPGQLTAAEINEAMHIMGALPKRDLYVIGSFRATPQSMFMEKCFNELSL
FT                   PHTLTSIDRGPKGTIEGVIMQPSFGGASVNPPISAATPYIPAVSEAARAIGLVDTIVVG
FT                   ESQSQSQSQSQSQSQSQSQSQPHGPPTARTLIGENATWKGIRATLTRDYVPSAYRGRAA
FT                   IILAGSESDASAAIYALRSLGVGSIYTVGFRATGPLAAGLEPFTSIQSVKLVEQPFVMV
FT                   SALPPEKSLLVQPLLRHYRSNGRTSPRSTRGKVYLDLTASSGERKGDPVGVAVNAGWTA
FT                   YGIDEVTAWTTVETMRLLVGQNVPFDFVRMASGRIY"
     MMQTAIHQPM AMTILADTAP SVTNNSASAP SPANGAHPPL ATAVSANSAV AAAPPSVPAD        60
     PPRTVVVVYR SGQDSIVHLV AEVLGKPWTT ETSLSTLVTG SNAVVVGILA AELARSLDEC       120
     DPSTLIVINT HCVDDGSSPD EALTDRCDYE FLYSHSPFLR RDLTRFLSLI LGQTRPHEDL       180
     KTKTRTNFIS TTFPDVHAAL PNLDILSVGS DAVEIRVDLL VEPSPQGVVS PVPSLRYVGQ       240
     QVMLLRQHTE LPIIFTTRCT KENGKFPMDD PMLFYRYLRR AIQWGCEYID VELWLPEEIR       300
     RRLAEQKGHS VIMSAFHDFS GTWKWTSPEA ARIFAESARY ADIVKMIAMV HTIEANYELE       360
     YFRSTVKARG AGDSSPLLSA VNMGQMGQLS RALNTVFSPI THPLLPMIAA PGQLTAAEIN       420
     EAMHIMGALP KRDLYVIGSF RATPQSMFME KCFNELSLPH TLTSIDRGPK GTIEGVIMQP       480
     SFGGASVNPP ISAATPYIPA VSEAARAIGL VDTIVVGESQ SQSQSQSQSQ SQSQSQSQPH       540
     GPPTARTLIG ENATWKGIRA TLTRDYVPSA YRGRAAIILA GSESDASAAI YALRSLGVGS       600
     IYTVGFRATG PLAAGLEPFT SIQSVKLVEQ PFVMVSALPP EKSLLVQPLL RHYRSNGRTS       660
     PRSTRGKVYL DLTASSGERK GDPVGVAVNA GWTAYGIDEV TAWTTVETMR LLVGQNVPFD       720
     FVRMASGRIY                                                              730
//

If you have problems or comments...

PBIL Back to PBIL home page