(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE431

ASFUM1_4.PE431       Location/Qualifiers
FT   CDS             join(complement(1660622..1660868),
FT                   complement(1658235..1660570),complement(1658031..1658198))
FT                   /codon_start=1
FT                   /gene_family="HOG000188023" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206603"
FT                   /orf_name="AFUA_4G06490"
FT                   /product="DNA mismatch repair protein (Mlh3), putative "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="EAL90139.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG054222"
FT                   /db_xref="HOGENOM:HBG324341"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="UniParc:UPI000051E479"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP5"
FT                   /transl_table=1
FT                   /translation="MPSEDSRIEPLPPEVVAKIKSSTSIINLNRVVVELVKNALDANAR
FT                   TVSVTVDFHRGGCVVEDDGDGIPPAEFESDGGLGKAHHTSKLYSARAVYGRRGLFLASL
FT                   ASLSLLTVISHHVRYNSTNSVIFHHSTPIARFIPAPSSHQLSCSSHGTRVIVNDLFGNM
FT                   PVRVKSRALALQKPDEFERQWDDLRRLLVSLILANDHLTKLVVSTAGKERKLMIRPHVG
FT                   RPGIRGDLDLKRIASILMQAGLIESQNSDSWNYVSASVPGISLRAAVSLVPSPTRKVQF
FT                   ISIGIDPVYPRNSTDLLYSEINRLFALSDFGAVEAAPVSSDGHPGPRFTSKAVNKWPMF
FT                   YIRIDVDDPRELFEEGHEVVPESNQSVQRLIDVLVAMMSEFLKQHGLRPRAGRQTKDVS
FT                   RSASVESPGAGRSNFAKSVSSRDRSSIAEEALAGQLKLPTFRRLTSTNTTSDFATWSRV
FT                   KCAREPPASKHELAGGLKKAHSGPAWESGDRESLSLCLETDDSSVGNNLDLEVTENDGS
FT                   DADASIPWTDPHTGYSHLINARTGQAINVRSPSTEITVDERPRSAGTIQTLRALDRSRP
FT                   RSAISSTSHNIWVESLLRRWENPAFRRPERPITAISDGESHRNMSDNGLIRPFDCSRGS
FT                   YGLDDFGLAKFRGRLSKSHLATANVIAQVDRKFILVKLADGRSSRSALVLIDQHAADER
FT                   CRIESLFGAMFADGHRQVQSIRIDPITFDIPLMEAALFGKHADSFASWGVGYTVERKSS
FT                   ARAALVVVTSLPTLIAERCRLEPDLVSDMIRGEIWKHEENGQGALALSDQRAQRSKVHR
FT                   DELGVETEGNWVDRLTSCPQGIIDLLNSRACRTAIMFNDMLTAEECKSLCAHGRPSMVP
FT                   ILDVRESEEFLGKSIECEYEYEREDGRRQLDFLEAFRSWQGLGGN"
     MPSEDSRIEP LPPEVVAKIK SSTSIINLNR VVVELVKNAL DANARTVSVT VDFHRGGCVV        60
     EDDGDGIPPA EFESDGGLGK AHHTSKLYSA RAVYGRRGLF LASLASLSLL TVISHHVRYN       120
     STNSVIFHHS TPIARFIPAP SSHQLSCSSH GTRVIVNDLF GNMPVRVKSR ALALQKPDEF       180
     ERQWDDLRRL LVSLILANDH LTKLVVSTAG KERKLMIRPH VGRPGIRGDL DLKRIASILM       240
     QAGLIESQNS DSWNYVSASV PGISLRAAVS LVPSPTRKVQ FISIGIDPVY PRNSTDLLYS       300
     EINRLFALSD FGAVEAAPVS SDGHPGPRFT SKAVNKWPMF YIRIDVDDPR ELFEEGHEVV       360
     PESNQSVQRL IDVLVAMMSE FLKQHGLRPR AGRQTKDVSR SASVESPGAG RSNFAKSVSS       420
     RDRSSIAEEA LAGQLKLPTF RRLTSTNTTS DFATWSRVKC AREPPASKHE LAGGLKKAHS       480
     GPAWESGDRE SLSLCLETDD SSVGNNLDLE VTENDGSDAD ASIPWTDPHT GYSHLINART       540
     GQAINVRSPS TEITVDERPR SAGTIQTLRA LDRSRPRSAI SSTSHNIWVE SLLRRWENPA       600
     FRRPERPITA ISDGESHRNM SDNGLIRPFD CSRGSYGLDD FGLAKFRGRL SKSHLATANV       660
     IAQVDRKFIL VKLADGRSSR SALVLIDQHA ADERCRIESL FGAMFADGHR QVQSIRIDPI       720
     TFDIPLMEAA LFGKHADSFA SWGVGYTVER KSSARAALVV VTSLPTLIAE RCRLEPDLVS       780
     DMIRGEIWKH EENGQGALAL SDQRAQRSKV HRDELGVETE GNWVDRLTSC PQGIIDLLNS       840
     RACRTAIMFN DMLTAEECKS LCAHGRPSMV PILDVRESEE FLGKSIECEY EYEREDGRRQ       900
     LDFLEAFRSW QGLGGN                                                       916
//

If you have problems or comments...

PBIL Back to PBIL home page