(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE432

ASFUM1_4.PE432       Location/Qualifiers
FT   CDS             join(complement(1663466..1663648),
FT                   complement(1662405..1663364))
FT                   /codon_start=1
FT                   /gene_family="HOG000188056" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16260081"
FT                   /orf_name="AFUA_4G06500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90138.2"
FT                   /db_xref="HOGENOM:HBG054221"
FT                   /db_xref="UniParc:UPI0000F51C46"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP6"
FT                   /transl_table=1
FT                   /translation="MGNFISLFLKGLIFPLKIIVKITARVIDLLEGKELYGLDHAILSV
FT                   EVPPAKGMWMNMGYWKHTSSFPEACEALLEQVLITAKLLNEDRTPITFDADNDFQSEPF
FT                   IHEMKLVDVGIGCGDQSLYLTRRLSRKAGIPTASAGGMREASSVRPLFDSYVGLTVVKS
FT                   QAEFARERLSQVRSTTDLAGASEETTDVKIFAANAADPSSWESSLHRAVFGQSVKGEPI
FT                   QECPKKTQTWLLALDTLYHFQPSRDRLFKCAYQDMQASIMAFDLLLSEHATLWEKFVLR
FT                   LMCLVAGMPYGNFVTKTGYKQILKHAGYESTLIEMRDISEHVFPGIARFLRKQDAELSK
FT                   YGMTIGRYKGAANAFDWWGQTGVVRGVIVVARRSENLGAE"
     MGNFISLFLK GLIFPLKIIV KITARVIDLL EGKELYGLDH AILSVEVPPA KGMWMNMGYW        60
     KHTSSFPEAC EALLEQVLIT AKLLNEDRTP ITFDADNDFQ SEPFIHEMKL VDVGIGCGDQ       120
     SLYLTRRLSR KAGIPTASAG GMREASSVRP LFDSYVGLTV VKSQAEFARE RLSQVRSTTD       180
     LAGASEETTD VKIFAANAAD PSSWESSLHR AVFGQSVKGE PIQECPKKTQ TWLLALDTLY       240
     HFQPSRDRLF KCAYQDMQAS IMAFDLLLSE HATLWEKFVL RLMCLVAGMP YGNFVTKTGY       300
     KQILKHAGYE STLIEMRDIS EHVFPGIARF LRKQDAELSK YGMTIGRYKG AANAFDWWGQ       360
     TGVVRGVIVV ARRSENLGAE                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page