(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE433

ASFUM1_4.PE433       Location/Qualifiers
FT   CDS             join(complement(1665777..1665896),
FT                   complement(1664459..1665712))
FT                   /codon_start=1
FT                   /gene_family="HOG000188045" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055345"
FT                   /orf_name="AFUA_4G06510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90137.1"
FT                   /db_xref="HOGENOM:HBG054220"
FT                   /db_xref="UniParc:UPI00005207E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP7"
FT                   /transl_table=1
FT                   /translation="MREASKQTVAVIGSGMAGLVAAFLLHRDSKGRYRVEVFEKQDQLS
FT                   LDSASYTLEAATDELPHRVDIPMRAFDDNYHINLKRMYDFLGIDYVSPKFLYSLSRICP
FT                   SSGKREPPYFIHSSSNHQVPPIRPRSRSRMDWIAETLYLTVCYFWFIVCCFVIGPKGKS
FT                   VSCGDESFRRYLERIRLPQYFSRRYLLPLLSSMTTCSHAELLDFPAIDVVDYATRTYRQ
FT                   PHYTVVGGVHRVQARISDGLAIRLHSTVTAVEAAGTRCRITWIDSQNDKVSSAEYDHVI
FT                   MAVTPDVVAAIFKPLEKPLRSIPTVKGDCIVHCDTSILPDGGLLCTEAKKALEPPEIMY
FT                   MVSDNNSTESVHIHRSSVMVTNFPIEPINSNKIIHRARLTRVLRTVRSREVVNRIFSAS
FT                   QSQNTLSEKEQLWRNGDGNVWLVGAWCWDGMVLLEGCIVSAMRVAACLGVDIPWSKEE"
     MREASKQTVA VIGSGMAGLV AAFLLHRDSK GRYRVEVFEK QDQLSLDSAS YTLEAATDEL        60
     PHRVDIPMRA FDDNYHINLK RMYDFLGIDY VSPKFLYSLS RICPSSGKRE PPYFIHSSSN       120
     HQVPPIRPRS RSRMDWIAET LYLTVCYFWF IVCCFVIGPK GKSVSCGDES FRRYLERIRL       180
     PQYFSRRYLL PLLSSMTTCS HAELLDFPAI DVVDYATRTY RQPHYTVVGG VHRVQARISD       240
     GLAIRLHSTV TAVEAAGTRC RITWIDSQND KVSSAEYDHV IMAVTPDVVA AIFKPLEKPL       300
     RSIPTVKGDC IVHCDTSILP DGGLLCTEAK KALEPPEIMY MVSDNNSTES VHIHRSSVMV       360
     TNFPIEPINS NKIIHRARLT RVLRTVRSRE VVNRIFSASQ SQNTLSEKEQ LWRNGDGNVW       420
     LVGAWCWDGM VLLEGCIVSA MRVAACLGVD IPWSKEE                                457
//

If you have problems or comments...

PBIL Back to PBIL home page