(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE434

ASFUM1_4.PE434       Location/Qualifiers
FT   CDS             join(1669026..1669059,1669118..1670427)
FT                   /codon_start=1
FT                   /gene_family="HOG000188034" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750033"
FT                   /orf_name="AFUA_4G06520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90136.2"
FT                   /db_xref="HOGENOM:HBG054219"
FT                   /db_xref="HOGENOM:HBG324338"
FT                   /db_xref="UniParc:UPI0000F51C34"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP8"
FT                   /transl_table=1
FT                   /translation="MATADVPARTHVRSGRRHPFSSWMKRLTGLKGSSTDSGTIRWSHK
FT                   RHDAHKNKRNNKNNPYPLSGTTNVVREYSSDFVPSVSDTNAANGPRSCSYSEPSIACSG
FT                   HDNQVPATSAKSTAPTISTNGDTAISEAAYSKSGTMATAGGGISSQGGGEGSTFSSPAP
FT                   SVRSLTTTLTTVQSAAPSIHFYNVQSTHQGLAHANSTHSNASQQVQFSQPFPSSPATAV
FT                   PPHLVPHGHSHTYSTATANNILTDNASILTLASSSKRRRRNSLDTNASVRALAPSSVFG
FT                   GSRESLPLSVLSANVGEPSNTSTFSTPGVLNRPSMVGLASAERISVYSASGAIASGERG
FT                   SYHNKPNPGAGDGASVKSAAYSHSRNDSYAASISGGMGVAIASGSVNQPMTGRVSRRSS
FT                   GWGEITGDECDREKEDKEERPAELKEEDSFDDVPEGTTETTTTVTTKN"
     MATADVPART HVRSGRRHPF SSWMKRLTGL KGSSTDSGTI RWSHKRHDAH KNKRNNKNNP        60
     YPLSGTTNVV REYSSDFVPS VSDTNAANGP RSCSYSEPSI ACSGHDNQVP ATSAKSTAPT       120
     ISTNGDTAIS EAAYSKSGTM ATAGGGISSQ GGGEGSTFSS PAPSVRSLTT TLTTVQSAAP       180
     SIHFYNVQST HQGLAHANST HSNASQQVQF SQPFPSSPAT AVPPHLVPHG HSHTYSTATA       240
     NNILTDNASI LTLASSSKRR RRNSLDTNAS VRALAPSSVF GGSRESLPLS VLSANVGEPS       300
     NTSTFSTPGV LNRPSMVGLA SAERISVYSA SGAIASGERG SYHNKPNPGA GDGASVKSAA       360
     YSHSRNDSYA ASISGGMGVA IASGSVNQPM TGRVSRRSSG WGEITGDECD REKEDKEERP       420
     AELKEEDSFD DVPEGTTETT TTVTTKN                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page