(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE435

ASFUM1_4.PE435       Location/Qualifiers
FT   CDS             join(complement(1674221..1674518),
FT                   complement(1673002..1673621))
FT                   /codon_start=1
FT                   /gene_family="HOG000188067" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16260082"
FT                   /orf_name="AFUA_4G06530"
FT                   /product="BZIP transcription factor (MetR), putative "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL90135.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG054218"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011700"
FT                   /db_xref="UniParc:UPI000051FEB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNP9"
FT                   /transl_table=1
FT                   /translation="MSGYNGRRAPNFSQYLEDLNAIPSPYDQALQQQQRQDTFNLDAEL
FT                   SLFTNTEFFDFDNLGDLNLPSFDAVNEDSAKTTDQQHGGPAAHNPDMEFLDLLGDGFGN
FT                   MPDFSAANLNSINSQFPAQDTQFSTIPSIPSGLSNAPFNANPTPSQSSSSAASPAGPAT
FT                   SPIAAQAPSATTAAGPKRKNTQKPAPMSVEEAARIAAEEDKRRRNTAASARFRVKKKLR
FT                   EQALEKTVKETTEKNAALEARVTALELENQWLKNLITEKNGKSAEETKKSETDIANMFK
FT                   KFLSSQKADAERSSSESKIGVGTA"
     MSGYNGRRAP NFSQYLEDLN AIPSPYDQAL QQQQRQDTFN LDAELSLFTN TEFFDFDNLG        60
     DLNLPSFDAV NEDSAKTTDQ QHGGPAAHNP DMEFLDLLGD GFGNMPDFSA ANLNSINSQF       120
     PAQDTQFSTI PSIPSGLSNA PFNANPTPSQ SSSSAASPAG PATSPIAAQA PSATTAAGPK       180
     RKNTQKPAPM SVEEAARIAA EEDKRRRNTA ASARFRVKKK LREQALEKTV KETTEKNAAL       240
     EARVTALELE NQWLKNLITE KNGKSAEETK KSETDIANMF KKFLSSQKAD AERSSSESKI       300
     GVGTA                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page