(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE436

ASFUM1_4.PE436       Location/Qualifiers
FT   CDS             1677281..1678693
FT                   /codon_start=1
FT                   /gene_family="HOG000188100" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902022"
FT                   /orf_name="AFUA_4G06540"
FT                   /product="CHL4 family chromosome segregation protein,
FT                   putative"
FT                   /protein_id="EAL90134.1"
FT                   /db_xref="HOGENOM:HBG054217"
FT                   /db_xref="HOGENOM:HBG324336"
FT                   /db_xref="InterPro:IPR007902"
FT                   /db_xref="UniParc:UPI000051E464"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ0"
FT                   /transl_table=1
FT                   /translation="MARPKAIRAPTAASLPNTLRLPSSTSSLIKSFSRLSRHALLDLVF
FT                   QWLDDRNAQLFPPYLQKDEIENPADDKLSPYPAAETIEDVRNAYQDLQDRKGGKREVID
FT                   RILEGDWRHGITLRQLAMVDIRYMEDHPASLRWTAFELSRIGMDGTQSAGATTPDVSAC
FT                   LPRIHATTFLSNLQQQISPLVKAHYHLVRSSSLPLSFLRILVTSSPYQNPRQPPEALMD
FT                   SSRVMYVAFPDSCPFIYTSIATSPVAKSNTTTNHAVATDARSLQRIVRDALPKALSRPQ
FT                   ERYALKATSLTAKNLQALLALRGPGRSNVAHGAFSIFADAVLEGSPLDPRPSDTISPRE
FT                   HFYQDLDKENENQEDGNTSKETEPSSHVAKKRKLAVHSRFGTTGTLSSAPLDRLDVRLL
FT                   DPADDEDDEHEVDHTQPSVSLTFVGSDVISGIRKLAELGVVDPERMPSWMTGEEAVSVA
FT                   VVHRGKRVVKAG"
     MARPKAIRAP TAASLPNTLR LPSSTSSLIK SFSRLSRHAL LDLVFQWLDD RNAQLFPPYL        60
     QKDEIENPAD DKLSPYPAAE TIEDVRNAYQ DLQDRKGGKR EVIDRILEGD WRHGITLRQL       120
     AMVDIRYMED HPASLRWTAF ELSRIGMDGT QSAGATTPDV SACLPRIHAT TFLSNLQQQI       180
     SPLVKAHYHL VRSSSLPLSF LRILVTSSPY QNPRQPPEAL MDSSRVMYVA FPDSCPFIYT       240
     SIATSPVAKS NTTTNHAVAT DARSLQRIVR DALPKALSRP QERYALKATS LTAKNLQALL       300
     ALRGPGRSNV AHGAFSIFAD AVLEGSPLDP RPSDTISPRE HFYQDLDKEN ENQEDGNTSK       360
     ETEPSSHVAK KRKLAVHSRF GTTGTLSSAP LDRLDVRLLD PADDEDDEHE VDHTQPSVSL       420
     TFVGSDVISG IRKLAELGVV DPERMPSWMT GEEAVSVAVV HRGKRVVKAG                  470
//

If you have problems or comments...

PBIL Back to PBIL home page