(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE439

ASFUM1_4.PE439       Location/Qualifiers
FT   CDS             join(complement(1686422..1686967),
FT                   complement(1683411..1686368))
FT                   /codon_start=1
FT                   /gene_family="HOG000188111" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902271"
FT                   /orf_name="AFUA_4G06570"
FT                   /product="Ras guanine-nucleotide exchange protein, putative"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL90131.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG324332"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="UniParc:UPI000051FC5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ3"
FT                   /transl_table=1
FT                   /translation="MEPMKRHIAPLKVEKTITNPCGSTTSESGDPSSNHHYSTQHSLQL
FT                   SPPLTPYCATSSKDNSMDRTEAPRAVFHNYLRAFYPFHPPGDVSPDTITLPLDQGDIIL
FT                   VHSVHTNGWADGTLLDTGARGWLPTNYCEAYDQLPMRPLLKALTDFWDIIRGGCGSSLR
FT                   DFGNQDLVRGLIAGVRFLLEKSECLTRDSFLVRRHEGLRRNRKALLSDLTALVRTTKSF
FT                   QVIASGNPLQDEVEYMVDEMLLKAFRVVTRGVRFLDIWNEEVGLSRTIAELEQSKDHTS
FT                   PLTPASETFVMSEKAPSEAETERNESRVLNSSRMSMSRCSTRVDMSEQPRPVSVATKRI
FT                   SISHRVSYSGPAAASRNPNLASERLNATYDAFLGVLGSFIGLHLQSRSSTELVVTTEQA
FT                   VRSCRGLLTVVEAVCEHDSQGSSLLESAKDAMYERLSELVFAARDAFRPAQSPDDELVF
FT                   MPDEGKRLVDAATDCVRAAGNCLAKARLVLEQVGDFELEALPQDVATPLVGAGPESQSQ
FT                   QQKGDQPELSMRLPPPPLQIPQNADLDSSPPTPGLTDDTTPSSSFNSRNLSNPTIAATD
FT                   EASLPSANIPPPSPAKSSFSSSCDAAAGVKVLENRISHPKSEIGESFGRGVTSTGSSFT
FT                   YHSHLRDSEMSGVSQTSTRATSPDIGSCYQAPSLKSCVSHSTLAEEGEETEVNILEKTY
FT                   AHELIFKDGQVMGGSLRALIERLTSHGSTPDAMFVSTFYLTFRLFATPLEFAEALVERF
FT                   NYIGDTPHAAGPVRLRVYNVFKGWLESHWRHDCDDSALDFIVNFAKTTLMQSLPSAGKR
FT                   LLELTDKVSTLQGPVVPRLISSIGKTNTATAQYVHPDTPLPPPILSKKEVNLLKQWKNG
FT                   EAAISILDFDPLELARQLTIKESRIFCAILPEELLATEWMKKSASLAVNVRAMSTLSTD
FT                   LAHLVADSILQLEEPKKRAAIIKQWVKIANKCLELNNYDTLMAIICSLNSSMISRLKRT
FT                   WEVVSQKTKATLETLRGIVDVSRNYAVLRQRLQTHVPPCLPFVGTYLTDLTFVDHGNQP
FT                   LRSLPTDDGEMTVINFDKHMKTAKIISELQRFQVPYRLTEVPELQTWMQNELVRVRSNG
FT                   EKSLQTFYRRSLILEPREITPRPNLQPESSASSIMENARDKFDLFAWTHPSKAKSVATN
FT                   S"
     MEPMKRHIAP LKVEKTITNP CGSTTSESGD PSSNHHYSTQ HSLQLSPPLT PYCATSSKDN        60
     SMDRTEAPRA VFHNYLRAFY PFHPPGDVSP DTITLPLDQG DIILVHSVHT NGWADGTLLD       120
     TGARGWLPTN YCEAYDQLPM RPLLKALTDF WDIIRGGCGS SLRDFGNQDL VRGLIAGVRF       180
     LLEKSECLTR DSFLVRRHEG LRRNRKALLS DLTALVRTTK SFQVIASGNP LQDEVEYMVD       240
     EMLLKAFRVV TRGVRFLDIW NEEVGLSRTI AELEQSKDHT SPLTPASETF VMSEKAPSEA       300
     ETERNESRVL NSSRMSMSRC STRVDMSEQP RPVSVATKRI SISHRVSYSG PAAASRNPNL       360
     ASERLNATYD AFLGVLGSFI GLHLQSRSST ELVVTTEQAV RSCRGLLTVV EAVCEHDSQG       420
     SSLLESAKDA MYERLSELVF AARDAFRPAQ SPDDELVFMP DEGKRLVDAA TDCVRAAGNC       480
     LAKARLVLEQ VGDFELEALP QDVATPLVGA GPESQSQQQK GDQPELSMRL PPPPLQIPQN       540
     ADLDSSPPTP GLTDDTTPSS SFNSRNLSNP TIAATDEASL PSANIPPPSP AKSSFSSSCD       600
     AAAGVKVLEN RISHPKSEIG ESFGRGVTST GSSFTYHSHL RDSEMSGVSQ TSTRATSPDI       660
     GSCYQAPSLK SCVSHSTLAE EGEETEVNIL EKTYAHELIF KDGQVMGGSL RALIERLTSH       720
     GSTPDAMFVS TFYLTFRLFA TPLEFAEALV ERFNYIGDTP HAAGPVRLRV YNVFKGWLES       780
     HWRHDCDDSA LDFIVNFAKT TLMQSLPSAG KRLLELTDKV STLQGPVVPR LISSIGKTNT       840
     ATAQYVHPDT PLPPPILSKK EVNLLKQWKN GEAAISILDF DPLELARQLT IKESRIFCAI       900
     LPEELLATEW MKKSASLAVN VRAMSTLSTD LAHLVADSIL QLEEPKKRAA IIKQWVKIAN       960
     KCLELNNYDT LMAIICSLNS SMISRLKRTW EVVSQKTKAT LETLRGIVDV SRNYAVLRQR      1020
     LQTHVPPCLP FVGTYLTDLT FVDHGNQPLR SLPTDDGEMT VINFDKHMKT AKIISELQRF      1080
     QVPYRLTEVP ELQTWMQNEL VRVRSNGEKS LQTFYRRSLI LEPREITPRP NLQPESSASS      1140
     IMENARDKFD LFAWTHPSKA KSVATNS                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page