(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE442

ASFUM1_4.PE442       Location/Qualifiers
FT   CDS             join(complement(1699266..1699872),
FT                   complement(1698964..1699214),complement(1698857..1698919),
FT                   complement(1698308..1698808),complement(1697724..1698255),
FT                   complement(1696607..1697676))
FT                   /codon_start=1
FT                   /gene_family="HOG000234637" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902272"
FT                   /gene_name="nut1"
FT                   /gene_synonym="med5"
FT                   /orf_name="AFUA_4G06600"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 5"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="EAL90128.2"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG054210"
FT                   /db_xref="HOGENOM:HBG324329"
FT                   /db_xref="InterPro:IPR014801"
FT                   /db_xref="UniParc:UPI0000F51BDF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNQ6"
FT                   /transl_table=1
FT                   /translation="MTSPVQWGTFFHQCLLHRIDANEFRNLSKLLLQKCPIAETALLDA
FT                   LLQTRSESRIKWDPLLPLYIDCLCRTGRVRTSTVLTSLLKYSSIHDKPQLSTSEGKDGS
FT                   KCYTLMTDIRVIQDTMLSVSTGSTPKTNAEAVAIFFAIIDWIHAVASWHNSHFDPGQHS
FT                   SGIMSSPDVVSLFESLGILLAALSGTGKGLEVLSADSHEGLKVKLGQALSAYLPLCVEV
FT                   SLPLRNRLDGLQKEFNLYGERVPKSLDVPMMENMNVNALQFEASVMDGPVINSRAGLYV
FT                   FINAMLVGRPLVDDGMLINYLANRYGGHYEALVEEILTASFDVLSNGMYRNESSRMMFV
FT                   FRSFLVNKLPPFFAAMLASTMVSIPMEMCISHALSRLDPNTFPSFSQMFEMQGNTVLSD
FT                   VRQEFLFACASHKLIPESSIERLLGENPMQTLPVGYNKDELVSQINANPERAEQLINEI
FT                   ESMEGNAGAIIGAITEVMHNLCNQKETMTLKNICNSLSRRPQALDVVLIFRNPKQVLQP
FT                   LCALLDSWHWDEDQGEYQPVYDEFGSILLLVLAFKYRFDLRPADLGISSSDSFVLRLLE
FT                   RGSCSQKLDALDEKQNKNLGSWIAALFIAEGISEETMSACSPQEFYLLVATLFSQSLEA
FT                   CETGKLEFDTLKGGFEYLLEPFLLPSLIFALTWLGDHIWEMELDPSIPLKVLHSLVNPS
FT                   SISGEAREIHRTVLNIAARTLEEQLKDVRTRHPSRTDIKPILDSLEPCLSFQLVGSSHR
FT                   SELEGWTTHSSGGLLGSIRSTFQSLVLWSTNPEVSMAPPPYTHRQLIAGVRMLGASRVL
FT                   PALIEELKLQTEAGNGPLALDLAATLICAPMAETFSVEQNSHQPVDPNKEALPRCGILT
FT                   LRDVLALQHENVPKISEKDPLRAEVLVRLYRRVNALLAPPSQVPNLDVNNIIQNMQLGG
FT                   VGVGAGQMELDATGAADHGVGPDDAENIHRMIDNAAAAAGLDSSGTGLDTSIDDVLNAA
FT                   DMAVGNPEFLDLDMEGMF"
     MTSPVQWGTF FHQCLLHRID ANEFRNLSKL LLQKCPIAET ALLDALLQTR SESRIKWDPL        60
     LPLYIDCLCR TGRVRTSTVL TSLLKYSSIH DKPQLSTSEG KDGSKCYTLM TDIRVIQDTM       120
     LSVSTGSTPK TNAEAVAIFF AIIDWIHAVA SWHNSHFDPG QHSSGIMSSP DVVSLFESLG       180
     ILLAALSGTG KGLEVLSADS HEGLKVKLGQ ALSAYLPLCV EVSLPLRNRL DGLQKEFNLY       240
     GERVPKSLDV PMMENMNVNA LQFEASVMDG PVINSRAGLY VFINAMLVGR PLVDDGMLIN       300
     YLANRYGGHY EALVEEILTA SFDVLSNGMY RNESSRMMFV FRSFLVNKLP PFFAAMLAST       360
     MVSIPMEMCI SHALSRLDPN TFPSFSQMFE MQGNTVLSDV RQEFLFACAS HKLIPESSIE       420
     RLLGENPMQT LPVGYNKDEL VSQINANPER AEQLINEIES MEGNAGAIIG AITEVMHNLC       480
     NQKETMTLKN ICNSLSRRPQ ALDVVLIFRN PKQVLQPLCA LLDSWHWDED QGEYQPVYDE       540
     FGSILLLVLA FKYRFDLRPA DLGISSSDSF VLRLLERGSC SQKLDALDEK QNKNLGSWIA       600
     ALFIAEGISE ETMSACSPQE FYLLVATLFS QSLEACETGK LEFDTLKGGF EYLLEPFLLP       660
     SLIFALTWLG DHIWEMELDP SIPLKVLHSL VNPSSISGEA REIHRTVLNI AARTLEEQLK       720
     DVRTRHPSRT DIKPILDSLE PCLSFQLVGS SHRSELEGWT THSSGGLLGS IRSTFQSLVL       780
     WSTNPEVSMA PPPYTHRQLI AGVRMLGASR VLPALIEELK LQTEAGNGPL ALDLAATLIC       840
     APMAETFSVE QNSHQPVDPN KEALPRCGIL TLRDVLALQH ENVPKISEKD PLRAEVLVRL       900
     YRRVNALLAP PSQVPNLDVN NIIQNMQLGG VGVGAGQMEL DATGAADHGV GPDDAENIHR       960
     MIDNAAAAAG LDSSGTGLDT SIDDVLNAAD MAVGNPEFLD LDMEGMF                    1007
//

If you have problems or comments...

PBIL Back to PBIL home page