(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE444

ASFUM1_4.PE444       Location/Qualifiers
FT   CDS             join(1708834..1708879,1708941..1710271)
FT                   /codon_start=1
FT                   /gene_family="HOG000243799" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16261072"
FT                   /orf_name="AFUA_4G06620"
FT                   /product="Glutamate/Leucine/Phenylalanine/Valine
FT                   dehydrogenase, putative"
FT                   /EC_number="1.4.1.4"
FT                   /function="binding"
FT                   /function="glutamate dehydrogenase (NADP+) activity "
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL90126.1"
FT                   /db_xref="GO:0004354"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG054208"
FT                   /db_xref="HOGENOM:HBG590661"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EDB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNQ8"
FT                   /transl_table=1
FT                   /translation="MSNLPHEPEFEQAYKELASTLENSTLFEKNPEYRKALAVVSVPER
FT                   VVQFRVVWEDDNHQVQINRGYRVQFNSALGPYKGGLRFHPSVNLSILKFLGFEQIFKNA
FT                   LTGLNMGGGKGGSDFDPKGKSDNEIRRFCVAFMTELCKHIGADTDVPAGDIGVTGREIG
FT                   FLFGQYRKIRNQWEGVLTGKGGSWGGSLIRPEATGYGLVYYVDHMIKYVTKGAESFAGK
FT                   RVAISGSGNVAQFAALKVIELGGSVVSLSDSKGSLVVNGEGSFTPAEIDIIAQLKVDRK
FT                   QLSEVATTEAFATKFKYIEGARPWVHVGKVDVALPSATQNEVSGEEAQALIDAGCKFIA
FT                   EGSNMGCTQAAIDIFEAHRQANPGAAAIWYAPGKAANAGGVAVSGLEMAQNSARISWTA
FT                   EEVDSRLKDIMESCFRNGLDTAVKYATPAEGVLPSLVTGSNIAGFTKVAEAMKEQGDWW
FT                   "
     MSNLPHEPEF EQAYKELAST LENSTLFEKN PEYRKALAVV SVPERVVQFR VVWEDDNHQV        60
     QINRGYRVQF NSALGPYKGG LRFHPSVNLS ILKFLGFEQI FKNALTGLNM GGGKGGSDFD       120
     PKGKSDNEIR RFCVAFMTEL CKHIGADTDV PAGDIGVTGR EIGFLFGQYR KIRNQWEGVL       180
     TGKGGSWGGS LIRPEATGYG LVYYVDHMIK YVTKGAESFA GKRVAISGSG NVAQFAALKV       240
     IELGGSVVSL SDSKGSLVVN GEGSFTPAEI DIIAQLKVDR KQLSEVATTE AFATKFKYIE       300
     GARPWVHVGK VDVALPSATQ NEVSGEEAQA LIDAGCKFIA EGSNMGCTQA AIDIFEAHRQ       360
     ANPGAAAIWY APGKAANAGG VAVSGLEMAQ NSARISWTAE EVDSRLKDIM ESCFRNGLDT       420
     AVKYATPAEG VLPSLVTGSN IAGFTKVAEA MKEQGDWW                               458
//

If you have problems or comments...

PBIL Back to PBIL home page