(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE447

ASFUM1_4.PE447       Location/Qualifiers
FT   CDS             join(complement(1722248..1722463),
FT                   complement(1721926..1722084))
FT                   /codon_start=1
FT                   /gene_family="HOG000048510" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055582"
FT                   /orf_name="AFUA_4G06660"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL90122.1"
FT                   /db_xref="HOGENOM:HBG054203"
FT                   /db_xref="UniParc:UPI00005207D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNR2"
FT                   /transl_table=1
FT                   /translation="MTFADRLAKDAARLGKTHPFPLLSRESACLPGNILHQWEQEMEGW
FT                   SPIERSKASFQKHTKEKAIWKPSQELSREVGDVFSSVSSLLGGLTKDKKGKPDTVSREK
FT                   TVKAALDFAEASQWFWSRAP"
     MTFADRLAKD AARLGKTHPF PLLSRESACL PGNILHQWEQ EMEGWSPIER SKASFQKHTK        60
     EKAIWKPSQE LSREVGDVFS SVSSLLGGLT KDKKGKPDTV SREKTVKAAL DFAEASQWFW       120
     SRAP                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page