(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE448

ASFUM1_4.PE448       Location/Qualifiers
FT   CDS             complement(1724024..1724836)
FT                   /codon_start=1
FT                   /gene_family="HOG000188145" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI19055583"
FT                   /orf_name="AFUA_4G06670"
FT                   /product="Allergen Asp f 7"
FT                   /protein_id="EAL90121.1"
FT                   /db_xref="EMBL:CAA11255.1"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR014733"
FT                   /db_xref="UniParc:UPI000051EB74"
FT                   /db_xref="UniProtKB/Swiss-Prot:O42799"
FT                   /transl_table=1
FT                   /translation="MAPIFKSLALVSALFAAISSAAPVNLDKREVDVVWTTVTTVVWTT
FT                   IDVTTTIYPTPQAPTPPVVESTPTPTPSAAPEQAEPIETSTQPETTKSQPTQPSVATFI
FT                   PVAAAAAAADSAAPIPEEPAPQPATTAAPSTSTTTQAAPSAPPAANSGSTEKAASSGYS
FT                   GPCSKGSPCVGQLTYYDTATSASAPSSCGLTNDGFSENVVALPVGIMTDADCGKTVTIT
FT                   YNGITKTATVVDKCMGCKPTDLDASRHLFGELADFSAGRIDGMSWYFN"
     MAPIFKSLAL VSALFAAISS AAPVNLDKRE VDVVWTTVTT VVWTTIDVTT TIYPTPQAPT        60
     PPVVESTPTP TPSAAPEQAE PIETSTQPET TKSQPTQPSV ATFIPVAAAA AAADSAAPIP       120
     EEPAPQPATT AAPSTSTTTQ AAPSAPPAAN SGSTEKAASS GYSGPCSKGS PCVGQLTYYD       180
     TATSASAPSS CGLTNDGFSE NVVALPVGIM TDADCGKTVT ITYNGITKTA TVVDKCMGCK       240
     PTDLDASRHL FGELADFSAG RIDGMSWYFN                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page