(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE450

ASFUM1_4.PE450       Location/Qualifiers
FT   CDS             join(complement(1731674..1731771),
FT                   complement(1731456..1731604),complement(1731125..1731372))
FT                   /codon_start=1
FT                   /gene_family="HOG000188156" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261074"
FT                   /orf_name="AFUA_4G06700"
FT                   /product="GPI anchored cell wall protein, putative "
FT                   /protein_id="EAL90118.2"
FT                   /db_xref="HOGENOM:HBG054199"
FT                   /db_xref="UniParc:UPI0000F51C47"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNR6"
FT                   /transl_table=1
FT                   /translation="MFFSKSTFVLSFLALGNIVAAAQTPACLLSVVGAEKNPADLKAVC
FT                   VTNGDDVQKKIANTCGDSEQAALSWFADTCDAAGYKVDIKSSTTTSESATGTSTKGSAS
FT                   NTGFVTATATGSSSSGENKSGTSSSSATSTSQTVSAGSSDRQVSAAAFAAVVFFGFAAT
FT                   L"
     MFFSKSTFVL SFLALGNIVA AAQTPACLLS VVGAEKNPAD LKAVCVTNGD DVQKKIANTC        60
     GDSEQAALSW FADTCDAAGY KVDIKSSTTT SESATGTSTK GSASNTGFVT ATATGSSSSG       120
     ENKSGTSSSS ATSTSQTVSA GSSDRQVSAA AFAAVVFFGF AATL                        164
//

If you have problems or comments...

PBIL Back to PBIL home page