(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE455

ASFUM1_4.PE455       Location/Qualifiers
FT   CDS             join(1743575..1744023,1744085..1744689,1744753..1745325,
FT                   1745416..1745663)
FT                   /codon_start=1
FT                   /gene_family="HOG000188189" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261077"
FT                   /orf_name="AFUA_4G06760"
FT                   /product="Ubiquinone biosynthesis protein, putative "
FT                   /protein_id="EAL90112.1"
FT                   /db_xref="HOGENOM:HBG054192"
FT                   /db_xref="HOGENOM:HBG324320"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0000520313"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS2"
FT                   /transl_table=1
FT                   /translation="MRVALRTPLRASDFDPAAVFRYNPNGFFLSQASKRNYSSTSSLRS
FT                   PASIQSSWRGISRHHSHARSSFRTCPSSRFYSTKTPILPEDIKSRDNRSGHSGSQRSRR
FT                   RLLKYAIIAGVVGATTVTLSDDVRHLYRAAQRTGRVVGTLAVCINDYRVTLKQDTPTEE
FT                   ERQEAIRACHKRCAERTLRVLEKNGSIFIKLGQHLSSMGYLLPLEWTTTFVPLQDKCPV
FT                   SSIESVEEMFVTDTGHRIDELFSSFEPLPIGAASLAQVHIGTLKETGQKVAVKVQHPAL
FT                   AEWVPLDLALTRFTFSMLKRFFPEYDLEWLSNEMDFSLPQELDFRMEAENARRASEYFK
FT                   NHSDAPLVIPEVMWAQKRILVMEFLSGHRPDDLEYLDSNHIDRDEVSAAFAHIFNEMIF
FT                   GDNAPLHCDPHGGNIAIRKNPNRRRHNFDIILYDHGLYRDIPRDLRRNYAKLWLAVIEA
FT                   DEGRMREYARKVAGITDEQFPLFASAITGRDYTVLANKDVASPRTAAEKENISGALGEG
FT                   MLQQLVELLGQVPRIILLILKTNDLTRSLDENLHTRQGPIRTFLILARYATRTVFEEKM
FT                   ENINETGGMLRPLNFLRFLWAWTGYLRVELKLSIYETLLSMKSQFGLI"
     MRVALRTPLR ASDFDPAAVF RYNPNGFFLS QASKRNYSST SSLRSPASIQ SSWRGISRHH        60
     SHARSSFRTC PSSRFYSTKT PILPEDIKSR DNRSGHSGSQ RSRRRLLKYA IIAGVVGATT       120
     VTLSDDVRHL YRAAQRTGRV VGTLAVCIND YRVTLKQDTP TEEERQEAIR ACHKRCAERT       180
     LRVLEKNGSI FIKLGQHLSS MGYLLPLEWT TTFVPLQDKC PVSSIESVEE MFVTDTGHRI       240
     DELFSSFEPL PIGAASLAQV HIGTLKETGQ KVAVKVQHPA LAEWVPLDLA LTRFTFSMLK       300
     RFFPEYDLEW LSNEMDFSLP QELDFRMEAE NARRASEYFK NHSDAPLVIP EVMWAQKRIL       360
     VMEFLSGHRP DDLEYLDSNH IDRDEVSAAF AHIFNEMIFG DNAPLHCDPH GGNIAIRKNP       420
     NRRRHNFDII LYDHGLYRDI PRDLRRNYAK LWLAVIEADE GRMREYARKV AGITDEQFPL       480
     FASAITGRDY TVLANKDVAS PRTAAEKENI SGALGEGMLQ QLVELLGQVP RIILLILKTN       540
     DLTRSLDENL HTRQGPIRTF LILARYATRT VFEEKMENIN ETGGMLRPLN FLRFLWAWTG       600
     YLRVELKLSI YETLLSMKSQ FGLI                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page