(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE456

ASFUM1_4.PE456       Location/Qualifiers
FT   CDS             join(complement(1747149..1747377),
FT                   complement(1746368..1746906))
FT                   /codon_start=1
FT                   /gene_family="HOG000069228" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206879"
FT                   /orf_name="AFUA_4G06770"
FT                   /product="Iron-sulfur cofactor synthesis protein (Isu1),
FT                   putative"
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="EAL90111.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG054191"
FT                   /db_xref="HOGENOM:HBG584215"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniParc:UPI000051E6C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS3"
FT                   /transl_table=1
FT                   /translation="MFRRLATVAPRSVGAVASPRIAPAISGIQSQPINRASPTPQRRNY
FT                   HEKDKYIDQSGMTSQMLTFFALLDHYNNPRNEDCYDQSTSICLLCARGESRVSAFFKLL
FT                   TNHVHASETDISIVGSLPKDAPDVGLGLVGAPACGDVMKLQIRVDKDTSKITDVKFKTF
FT                   GCGSAIASSSYLTELVRGMTLDEAAKIRNTDIAKELCLPPVKLHCSMLAEDAIKSAIND
FT                   YYTKNPKAAKTDLSGTAASISNVEKTDGSTASL"
     MFRRLATVAP RSVGAVASPR IAPAISGIQS QPINRASPTP QRRNYHEKDK YIDQSGMTSQ        60
     MLTFFALLDH YNNPRNEDCY DQSTSICLLC ARGESRVSAF FKLLTNHVHA SETDISIVGS       120
     LPKDAPDVGL GLVGAPACGD VMKLQIRVDK DTSKITDVKF KTFGCGSAIA SSSYLTELVR       180
     GMTLDEAAKI RNTDIAKELC LPPVKLHCSM LAEDAIKSAI NDYYTKNPKA AKTDLSGTAA       240
     SISNVEKTDG STASL                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page