(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE457

ASFUM1_4.PE457       Location/Qualifiers
FT   CDS             join(complement(1750474..1750945),
FT                   complement(1749623..1750344))
FT                   /codon_start=1
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902274"
FT                   /orf_name="AFUA_4G06780"
FT                   /product="Mitochondrial carrier protein, putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL90110.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG054190"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000051FC50"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS4"
FT                   /transl_table=1
FT                   /translation="MFSDGHGNSGATSSSEEQQISQSNNLASSDIQVPPEAASSPKFVT
FT                   NLEIWSTKIPDYYVAPFCGASAGVASGIVTCPLDVIKTKLQAQGGFLRRGGGVVEAKTL
FT                   YRGMLGTGRIIWRQDGIRGLYQGLGPMLLGYLPTWAVYLAVYDRSREYFYETTVTNPIW
FT                   VIKTRLMSQSLKSNSEGYTAPWQYSSTWDAARKMYRIEGIRSFYSGLTPALLGLTHVAI
FT                   QFPLYEYLKMAFTGYGIGEHPDNGGSHWIGISCATFLSKVCASTLTYPHEVLRTRLQTQ
FT                   QRTSPAPSPEGISFRGGLDHPQDRGRPPGAASSDGMPNRPRYTGVIRTCQTILREEGWR
FT                   AFYSGIGVNLFRAVPAAMTTMLTYEYLRKLIGHLQHEGEMKLRMANDREIALLQQDE"
     MFSDGHGNSG ATSSSEEQQI SQSNNLASSD IQVPPEAASS PKFVTNLEIW STKIPDYYVA        60
     PFCGASAGVA SGIVTCPLDV IKTKLQAQGG FLRRGGGVVE AKTLYRGMLG TGRIIWRQDG       120
     IRGLYQGLGP MLLGYLPTWA VYLAVYDRSR EYFYETTVTN PIWVIKTRLM SQSLKSNSEG       180
     YTAPWQYSST WDAARKMYRI EGIRSFYSGL TPALLGLTHV AIQFPLYEYL KMAFTGYGIG       240
     EHPDNGGSHW IGISCATFLS KVCASTLTYP HEVLRTRLQT QQRTSPAPSP EGISFRGGLD       300
     HPQDRGRPPG AASSDGMPNR PRYTGVIRTC QTILREEGWR AFYSGIGVNL FRAVPAAMTT       360
     MLTYEYLRKL IGHLQHEGEM KLRMANDREI ALLQQDE                                397
//

If you have problems or comments...

PBIL Back to PBIL home page