(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE458

ASFUM1_4.PE458       Location/Qualifiers
FT   CDS             join(1751971..1752108,1752166..1752219,1752408..1752497)
FT                   /codon_start=1
FT                   /gene_family="HOG000188221" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206880"
FT                   /orf_name="AFUA_4G06790"
FT                   /product="Ubiquinol-cytochrome c reductase complex 14 kDa
FT                   protein"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="mitochondrial electron transport,
FT                   ubiquinol to cytochrome c"
FT                   /protein_id="EAL90109.2"
FT                   /db_xref="GO:0006122"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG054189"
FT                   /db_xref="HOGENOM:HBG324319"
FT                   /db_xref="InterPro:IPR003197"
FT                   /db_xref="UniParc:UPI0000F51C05"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNS5"
FT                   /transl_table=1
FT                   /translation="MQAVKLIILRFDDLIPEESDVVQTALKRLPPKEAYDRVFRIRRAF
FT                   QCSVSHTLLPAHEHTKPEEDVEYLSPIIREIERENKERVDLDTLVVRR"
     MQAVKLIILR FDDLIPEESD VVQTALKRLP PKEAYDRVFR IRRAFQCSVS HTLLPAHEHT        60
     KPEEDVEYLS PIIREIEREN KERVDLDTLV VRR                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page