(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE49

ASFUM1_4.PE49        Location/Qualifiers
FT   CDS             join(complement(165039..165685),complement(164542..164983))
FT                   /codon_start=1
FT                   /gene_family="HOG000200300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273697"
FT                   /orf_name="AFUA_4G00600"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL84358.1"
FT                   /db_xref="HOGENOM:HBG054006"
FT                   /db_xref="HOGENOM:HBG324891"
FT                   /db_xref="UniParc:UPI000051F9B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W983"
FT                   /transl_table=1
FT                   /translation="MVALYDAFGFPIVRDQLIANTVLVALATLAVLLRFISRHIRKSKI
FT                   WWDDGCCVGSMLHTYGMLAMHYHYARVGMRKHVTEIPPENLVAMLKMLIVYQVVYYNAM
FT                   VLAKLSYLFFYLRIFVTKGFRIAAWVCMGCACAYWTGSMLQIFFICQPFQKNWNPTLPG
FT                   HCASQNVAFSTIGAFNLITDVMIMVLPLHFIWKLQMSTATKLALYGIFGLGLFISAITI
FT                   IRIRVLTTVDFFDLPYSMIWAAFWSVTEPALANLNACVPMLRPVFKAAFPTLFASRKMY
FT                   STQPGSGASGIKNKAFKRMNEVESDLQLTNLTQLEPVRTSREGRISEHGDDGSHDDRSQ
FT                   DGRSQDESTHVPRSVIVNRPWT"
     MVALYDAFGF PIVRDQLIAN TVLVALATLA VLLRFISRHI RKSKIWWDDG CCVGSMLHTY        60
     GMLAMHYHYA RVGMRKHVTE IPPENLVAML KMLIVYQVVY YNAMVLAKLS YLFFYLRIFV       120
     TKGFRIAAWV CMGCACAYWT GSMLQIFFIC QPFQKNWNPT LPGHCASQNV AFSTIGAFNL       180
     ITDVMIMVLP LHFIWKLQMS TATKLALYGI FGLGLFISAI TIIRIRVLTT VDFFDLPYSM       240
     IWAAFWSVTE PALANLNACV PMLRPVFKAA FPTLFASRKM YSTQPGSGAS GIKNKAFKRM       300
     NEVESDLQLT NLTQLEPVRT SREGRISEHG DDGSHDDRSQ DGRSQDESTH VPRSVIVNRP       360
     WT                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page