(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE54

ASFUM1_4.PE54        Location/Qualifiers
FT   CDS             join(complement(177707..177786),complement(175503..176122),
FT                   complement(174498..175048))
FT                   /codon_start=1
FT                   /gene_family="HOG000174648" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058742"
FT                   /orf_name="AFUA_4G00650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84353.1"
FT                   /db_xref="HOGENOM:HBG055121"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000052009A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W988"
FT                   /transl_table=1
FT                   /translation="MIIKWVLRHIGACLAKDDNTPKEGYLYYNDALRHHERRRAFNISE
FT                   LKRLAALAVQQKEDDVASFEKLAEGGFNRSFKITMRDGFQFVARIPYPVTEPKSLLVAS
FT                   EVATIDFLRSHGIPVPKIYSYSAVADNPAGTEYIFMELVQGQNLGDIWFTLSEQERITL
FT                   VTKLVQLESRLFGLQFPASGSLYYYDDLPAHDNPVIVPSPSSTRCFCLGPGTSLGLWNG
FT                   KRLHLPVERGPCPYFTEDFNELEEIHQVQHAELFRKRQLHYLYVKLTAEKNPEHYDALT
FT                   YHFSTLRRQVFHRASDPWKGDNMTLKADLVTLSRNWGELTGDARIPCPIFFSRDESSEC
FT                   LRLARQQSDADKQFQACQEAIGVANEGWVPVEYYDEAKGRERKLQADALDAAETEEERV
FT                   RINENWIFDDFCEEDYT"
     MIIKWVLRHI GACLAKDDNT PKEGYLYYND ALRHHERRRA FNISELKRLA ALAVQQKEDD        60
     VASFEKLAEG GFNRSFKITM RDGFQFVARI PYPVTEPKSL LVASEVATID FLRSHGIPVP       120
     KIYSYSAVAD NPAGTEYIFM ELVQGQNLGD IWFTLSEQER ITLVTKLVQL ESRLFGLQFP       180
     ASGSLYYYDD LPAHDNPVIV PSPSSTRCFC LGPGTSLGLW NGKRLHLPVE RGPCPYFTED       240
     FNELEEIHQV QHAELFRKRQ LHYLYVKLTA EKNPEHYDAL TYHFSTLRRQ VFHRASDPWK       300
     GDNMTLKADL VTLSRNWGEL TGDARIPCPI FFSRDESSEC LRLARQQSDA DKQFQACQEA       360
     IGVANEGWVP VEYYDEAKGR ERKLQADALD AAETEEERVR INENWIFDDF CEEDYT           416
//

If you have problems or comments...

PBIL Back to PBIL home page