(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE55

ASFUM1_4.PE55        Location/Qualifiers
FT   CDS             join(complement(181108..184079),complement(180770..181061),
FT                   complement(180320..180721))
FT                   /codon_start=1
FT                   /gene_family="HOG000200267" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19058743"
FT                   /orf_name="AFUA_4G00660"
FT                   /product="Sensor histidine kinase/response regulator,
FT                   putative"
FT                   /function="ATP binding"
FT                   /function="two-component response regulator activity "
FT                   /function="two-component sensor activity"
FT                   /biological_process="peptidyl-histidine phosphorylation "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84352.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0018106"
FT                   /db_xref="HOGENOM:HBG055110"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniParc:UPI000051F744"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W989"
FT                   /transl_table=1
FT                   /translation="MQSSYLPYWGFSDSEKFAQESIGQHPNVSRDNVLTVFAQLAALRM
FT                   HARRALISLFDKTTQHVVAEATPDLSLRAADGRDQADALWLGVRRLPRKKVTMCYHAVK
FT                   SFIEEGRGIFVANDLTSDDRFKNHPSVTGHPHNRFYVSVPITSPDDYVIGSLAVLDDRP
FT                   RDGVTEDQERLLKELSATVMDHLLCQRAMREEYREERMVRALGLFVKGKSDLNEWFDSG
FT                   DARDKKYGGQMGLLNKRLEKRQVARSTREDSQGARDNKDGKDDKDDDAGQYQDNELSEA
FT                   RSKHRRGMHGSPVQRFKQGGEHEADEAGNDDKPDEKPRKKRPTLSPTTSQLQDSLAPTN
FT                   VRSVVNRAASMIYQALDVEGAMFIDASVYARRQTVGFTKSKLDNPEAYHGQQSPDIAGA
FT                   EEPAPSISNPESRSDTDASDDDSQSRSLVLGHYTSTTSEAGVNLDDSHYVSLSGNFINH
FT                   LIDQYPRGKIFHIEEDGSSSLSYEGLADERSYSRTGNRGATSTEPEKKDIQQETMDIKE
FT                   MMKVLPDARCIAVYPVWDFQRGRWFTVCVVWANDPGRVLFEPKDLTYLAAFSNTVMAEV
FT                   SRLDLEAADRAKSDFISSISHELRSPLHGLLGTMELLQGMVNSYAQKSLIETVYSCGRT
FT                   LLDTLNHLLDYAKINTLTRPRPSEKAIAQGSDMSQPQSAVPGSLQIENLSVLVQEVVEG
FT                   LLAGAEYQRRGASGDSDALAKKEDLSLKNHLITIVDIEWQDSWRFSVYAGAWRRVVMNL
FT                   FGNALKYTQAGYIRLRMRRDTLLVDGKRTPAIRMTFSDSGRGMSKDFLTNHLYSAFLQE
FT                   DTTSPGLGVGLHLVHQIIKSLKGQIKFASEVGKGTDVDVVLPIELPEVPSPSSPRSFAS
FT                   LKERLSGMTVSLFTRSSKLGDLGFDPRVFDRIRSSLGRMVSGWFGLRVLTPDELDSTKP
FT                   DFAIVTEHEYRNYYVKGTNEPKPDSGEIQPALPLIVLSARTSSWKTLGESVEDSVIFLT
FT                   QPVSPKTLATAFEHCMGQPERSRSSSPRKLPSPVRSVEHAPPNTDRLFEGMVNGEKDQA
FT                   LEPVLGRTVIDEAGQHNVDGDGRKGAKNILLVEDNQVNLKLIEMCVKTTGFSYGTAKNG
FT                   LEALEKFKTGTYDAVVMGELTSVILHSAHLTSADISMPVMDGLTATRQMRAFERKNKRP
FT                   ATTIIILTAVLSASMQHEAMMSGVNLFLTKPTPLKQLKEILRNLSDGKDVSHIQL"
     MQSSYLPYWG FSDSEKFAQE SIGQHPNVSR DNVLTVFAQL AALRMHARRA LISLFDKTTQ        60
     HVVAEATPDL SLRAADGRDQ ADALWLGVRR LPRKKVTMCY HAVKSFIEEG RGIFVANDLT       120
     SDDRFKNHPS VTGHPHNRFY VSVPITSPDD YVIGSLAVLD DRPRDGVTED QERLLKELSA       180
     TVMDHLLCQR AMREEYREER MVRALGLFVK GKSDLNEWFD SGDARDKKYG GQMGLLNKRL       240
     EKRQVARSTR EDSQGARDNK DGKDDKDDDA GQYQDNELSE ARSKHRRGMH GSPVQRFKQG       300
     GEHEADEAGN DDKPDEKPRK KRPTLSPTTS QLQDSLAPTN VRSVVNRAAS MIYQALDVEG       360
     AMFIDASVYA RRQTVGFTKS KLDNPEAYHG QQSPDIAGAE EPAPSISNPE SRSDTDASDD       420
     DSQSRSLVLG HYTSTTSEAG VNLDDSHYVS LSGNFINHLI DQYPRGKIFH IEEDGSSSLS       480
     YEGLADERSY SRTGNRGATS TEPEKKDIQQ ETMDIKEMMK VLPDARCIAV YPVWDFQRGR       540
     WFTVCVVWAN DPGRVLFEPK DLTYLAAFSN TVMAEVSRLD LEAADRAKSD FISSISHELR       600
     SPLHGLLGTM ELLQGMVNSY AQKSLIETVY SCGRTLLDTL NHLLDYAKIN TLTRPRPSEK       660
     AIAQGSDMSQ PQSAVPGSLQ IENLSVLVQE VVEGLLAGAE YQRRGASGDS DALAKKEDLS       720
     LKNHLITIVD IEWQDSWRFS VYAGAWRRVV MNLFGNALKY TQAGYIRLRM RRDTLLVDGK       780
     RTPAIRMTFS DSGRGMSKDF LTNHLYSAFL QEDTTSPGLG VGLHLVHQII KSLKGQIKFA       840
     SEVGKGTDVD VVLPIELPEV PSPSSPRSFA SLKERLSGMT VSLFTRSSKL GDLGFDPRVF       900
     DRIRSSLGRM VSGWFGLRVL TPDELDSTKP DFAIVTEHEY RNYYVKGTNE PKPDSGEIQP       960
     ALPLIVLSAR TSSWKTLGES VEDSVIFLTQ PVSPKTLATA FEHCMGQPER SRSSSPRKLP      1020
     SPVRSVEHAP PNTDRLFEGM VNGEKDQALE PVLGRTVIDE AGQHNVDGDG RKGAKNILLV      1080
     EDNQVNLKLI EMCVKTTGFS YGTAKNGLEA LEKFKTGTYD AVVMGELTSV ILHSAHLTSA      1140
     DISMPVMDGL TATRQMRAFE RKNKRPATTI IILTAVLSAS MQHEAMMSGV NLFLTKPTPL      1200
     KQLKEILRNL SDGKDVSHIQ L                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page