(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_4.PE56

ASFUM1_4.PE56        Location/Qualifiers
FT   CDS             join(185434..185693,185740..186241)
FT                   /codon_start=1
FT                   /gene_family="HOG000200256" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16273699"
FT                   /orf_name="AFUA_4G00670"
FT                   /product="Nucleoside-diphosphate-sugar epimerases, putative"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84351.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG055099"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F4DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W990"
FT                   /transl_table=1
FT                   /translation="MHLILTGATGLVGSGVLDAMLAMKEVTKISILSRRPVQMAEDAHD
FT                   PRVQVILHQGFEAYDPKVLSQLQGATGCVWALGISQTKVNKEDYIKITKTYALEAAKAF
FT                   RTLPPPNQPFHFVYVSGTGATTQPGFFTSLFARVKGETELELAELRRATPLFRASSVRP
FT                   AFIDHAHHEAIKKYVPPRPTYETLFRPLAPVFRAAMPGLCSPTEQLGRFLTEMAMGRHE
FT                   DRLVGGKDVQMVGEMPILENMAFRRLAGLRL"
     MHLILTGATG LVGSGVLDAM LAMKEVTKIS ILSRRPVQMA EDAHDPRVQV ILHQGFEAYD        60
     PKVLSQLQGA TGCVWALGIS QTKVNKEDYI KITKTYALEA AKAFRTLPPP NQPFHFVYVS       120
     GTGATTQPGF FTSLFARVKG ETELELAELR RATPLFRASS VRPAFIDHAH HEAIKKYVPP       180
     RPTYETLFRP LAPVFRAAMP GLCSPTEQLG RFLTEMAMGR HEDRLVGGKD VQMVGEMPIL       240
     ENMAFRRLAG LRL                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page